TGIF2LX (TGFB induced factor homeobox 2 like X-linked)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 90316
Gene name TGFB induced factor homeobox 2 like X-linked
Gene symbol TGIF2LX
Synonyms (NCBI Gene)
TGIFLX
Chromosome X
Chromosome location Xq21.31
Summary This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018011 hsa-miR-335-5p Microarray 18185580
MIRT531343 hsa-miR-4704-5p PAR-CLIP 22012620
MIRT531342 hsa-miR-205-3p PAR-CLIP 22012620
MIRT531341 hsa-miR-216b-3p PAR-CLIP 22012620
MIRT531340 hsa-miR-138-2-3p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300411 18570 ENSG00000153779
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IUE1
Protein name Homeobox protein TGIF2LX (TGF-beta-induced transcription factor 2-like protein) (TGFB-induced factor 2-like protein, X-linked) (TGIF-like on the X)
Protein function May have a transcription role in testis.
PDB 2DMN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05920 Homeobox_KN 68 → 107 Homeobox KN domain Family
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in adult testis.
Sequence 
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAE
SVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDP
IIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPS
QKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPN
P
Sequence length 241
Interactions View interactions

No strongly related genes found yet for TGIF2LX.

No additional diseases found yet through genes similar to TGIF2LX.