TGFBR3L (transforming growth factor beta receptor 3 like)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100507588
Gene name Transforming growth factor beta receptor 3 like
Gene symbol TGFBR3L
Synonyms (NCBI Gene)
GEMPTGFR-3L
Chromosome 19
Chromosome location 19p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001837 Process Epithelial to mesenchymal transition IBA
GO:0005024 Function Transforming growth factor beta receptor activity IBA
GO:0005114 Function Type II transforming growth factor beta receptor binding IBA
GO:0005539 Function Glycosaminoglycan binding IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H3BV60
Protein name Transforming growth factor-beta receptor type 3-like protein (TGF-beta receptor type-3-like protein) (TGFR-3L) (Transforming growth factor-beta receptor type III-like protein) (TGF-beta receptor type III-like protein)
Protein function Expressed in gonadotrope cells, acts as an inhibin B coreceptor and regulates follicle-stimulating hormone (FSH) levels and female fertility.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00100 Zona_pellucida 38 → 186 Zona pellucida-like domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in pituitary gland gonadotrope cells. {ECO:0000269|PubMed:33396509, ECO:0000269|PubMed:34910520}.
Sequence 
MGESAAATASLFQRRRRGRGGRVTFPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRR
PLFSLKLSDTEDVFPRRAGPLEVPADSRVFVQAALARPSPRWGLALHRCSVTPSSRPAPG
PALALLREGCPADTSVAFPPPPPPSPGAARPARFSFRLRPVFNASVQFLHCQLSRCRRLR
GVRRAPAPLTPPPPPPPSRCLPQDEACADTGSGSAEGLAADGPHLHTLTQPIVVTVPRPP
PRPPKSVPGRAVRPEPPAPAPAALEPAPVVALVLAAFVLGAALAAGLGLVCAHSAPHAPG
PPARASPSGPQPRRSQ
Sequence length 316
Interactions View interactions

No strongly related genes found yet for TGFBR3L.

No additional diseases found yet through genes similar to TGFBR3L.