Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7048
Gene name	Transforming growth factor beta receptor 2
Gene symbol	TGFBR2
Synonyms (NCBI Gene)	AAT3FAA3LDS1BLDS2LDS2BMFS2RIICTAAD2TBR-iiTBRIITGFR-2TGFbeta-RIItbetaR-II
Chromosome	3
Chromosome location	3p24.1
Summary	The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucle

Show/Hide all (77)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28934568	T>C	Pathogenic	Missense variant, coding sequence variant
rs34833812	C>T	Conflicting-interpretations-of-pathogenicity, pathogenic, benign-likely-benign, benign, likely-pathogenic, likely-benign	Coding sequence variant, missense variant
rs35719192	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign	Coding sequence variant, missense variant
rs35766612	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign, benign, likely-benign, not-provided	Coding sequence variant, missense variant
rs61732532	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, coding sequence variant, missense variant, genic upstream transcript variant
rs79375991	A>-,AA	Uncertain-significance, benign, likely-pathogenic	Frameshift variant, coding sequence variant
rs104893807	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs104893809	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893810	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893811	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893812	T>A,G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104893813	G>A,C,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104893814	G>T	Pathogenic	Missense variant, coding sequence variant
rs104893815	G>A	Pathogenic	Missense variant, coding sequence variant
rs104893816	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs104893817	A>C,G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104893818	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893819	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs112215250	T>A	Benign, conflicting-interpretations-of-pathogenicity, benign-likely-benign, likely-benign	Missense variant, coding sequence variant
rs121918714	G>C	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs121918715	G>A	Pathogenic	Synonymous variant, coding sequence variant
rs138262219	C>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Genic upstream transcript variant, missense variant, intron variant, coding sequence variant
rs150022335	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs193922660	A>G	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs193922664	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs193922665	C>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs199660234	C>G,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs200630803	A>C,G	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs377499122	G>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs397516840	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs587776769	->TG	Pathogenic	Coding sequence variant, frameshift variant
rs587776770	A>G	Pathogenic	Splice acceptor variant
rs587782979	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs727503475	G>A,T	Pathogenic, likely-pathogenic	Splice donor variant
rs727503476	C>T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs727503477	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs727504292	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs727504406	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Missense variant, coding sequence variant
rs727504421	G>A,T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs730880224	C>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs768385200	A>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Coding sequence variant, missense variant
rs768508812	C>G,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, synonymous variant
rs779131465	A>G	Pathogenic	Splice acceptor variant
rs863223841	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863223842	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs863223843	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs863223844	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863223845	G>A,T	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs863223847	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs863223848	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863223849	G>A	Pathogenic	Missense variant, coding sequence variant
rs863223850	C>T	Pathogenic	Missense variant, coding sequence variant
rs863223851	T>G	Likely-pathogenic	Missense variant, coding sequence variant
rs863223852	C>A,T	Pathogenic, uncertain-significance	Stop gained, coding sequence variant, synonymous variant
rs863223853	G>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs863223854	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs863223857	A>G	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs863224935	T>A,G	Likely-pathogenic, pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs869025537	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs876658120	ACGTTGACTGAG>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs878854610	A>G,T	Pathogenic	Missense variant, coding sequence variant
rs878854611	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs886038787	A>G	Pathogenic	Missense variant, coding sequence variant
rs886038794	G>T	Pathogenic	Missense variant, coding sequence variant
rs886038847	A>T	Pathogenic	Missense variant, coding sequence variant
rs886039106	G>A	Pathogenic	Missense variant, coding sequence variant
rs886039551	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1057524810	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1060501984	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1553630221	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1553630426	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1553630457	T>C	Pathogenic	Missense variant, coding sequence variant
rs1553631693	G>A	Pathogenic	Splice acceptor variant
rs1559466824	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1559472349	CT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1575165272	G>A	Pathogenic	Stop gained, coding sequence variant
rs1575166666	T>C	Likely-pathogenic	Missense variant, coding sequence variant

1022

Show/Hide all (1022)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001189	hsa-miR-21-5p	qRT-PCRWestern blot	19906824
MIRT001189	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayWestern blot	19816956
MIRT001189	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayWestern blot	19816956
MIRT004591	hsa-miR-17-5p	Review	20144731
MIRT004592	hsa-miR-18a-5p	Review	20144731
MIRT004593	hsa-miR-19a-3p	Review	20144731
MIRT004594	hsa-miR-19b-3p	Review	20144731
MIRT001785	hsa-miR-20a-5p	Review	20144731
MIRT004619	hsa-miR-590-5p	Luciferase reporter assayqRT-PCRWestern blot	19398468
MIRT003272	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003272	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003272	hsa-miR-204-5p	TargetScan	20056717
MIRT004591	hsa-miR-17-5p	ImmunoblotLuciferase reporter assayMicroarrayqRT-PCRWestern blot	20940405
MIRT001785	hsa-miR-20a-5p	ImmunoblotLuciferase reporter assayMicroarrayqRT-PCRWestern blot	20940405
MIRT004594	hsa-miR-19b-3p	MicroarrayqRT-PCR	19435428
MIRT001785	hsa-miR-20a-5p	MicroarrayqRT-PCR	19435428
MIRT004737	hsa-miR-92a-3p	MicroarrayqRT-PCR	19435428
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	18829576
MIRT001785	hsa-miR-20a-5p	and lung tumor samples"	16461460
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayMicroarray	20940405
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004737	hsa-miR-92a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayMicroarray	20940405
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004737	hsa-miR-92a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayMicroarray	20940405
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004737	hsa-miR-92a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayMicroarray	20940405
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assayMicroarray	20940405
MIRT004737	hsa-miR-92a-3p	Luciferase reporter assayMicroarray	20940405
MIRT003272	hsa-miR-204-5p	Microarray	21282569
MIRT005930	hsa-miR-302b-3p	ImmunocytochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21490602
MIRT005930	hsa-miR-302b-3p	ImmunocytochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21490602
MIRT005931	hsa-miR-372-3p	ImmunocytochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21490602
MIRT005931	hsa-miR-372-3p	ImmunocytochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21490602
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayWestern blot	22072622
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayWestern blot	22072622
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayWestern blot	22072622
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayWestern blot	22072622
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayWestern blot	22072622
MIRT001189	hsa-miR-21-5p	Luciferase reporter assayWestern blot	22072622
MIRT006825	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCR	22912877
MIRT006825	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCR	22912877
MIRT006840	hsa-miR-370-3p	GFP reporter assayLacZ reporter assayLuciferase reporter assayqRT-PCRWestern blot	21666718
MIRT006840	hsa-miR-370-3p	GFP reporter assayLacZ reporter assayLuciferase reporter assayqRT-PCRWestern blot	21666718
MIRT016729	hsa-miR-335-5p	Microarray	18185580
MIRT020143	hsa-miR-130b-3p	Sequencing	20371350
MIRT027974	hsa-miR-93-5p	Sequencing	20371350
MIRT001189	hsa-miR-21-5p	Reporter assay	19816956
MIRT001189	hsa-miR-21-5p	Microarray	18591254
MIRT001785	hsa-miR-20a-5p	Reporter assay	16461460
MIRT004594	hsa-miR-19b-3p	Sequencing	20371350
MIRT053287	hsa-miR-34b-5p	Luciferase reporter assayqRT-PCRWestern blot	22336710
MIRT005931	hsa-miR-372-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT053301	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT053652	hsa-miR-145-5p	Microarray	22942087
MIRT053735	hsa-miR-630	Microarray	22942087
MIRT001189	hsa-miR-21-5p	22Rv1	24037531
MIRT054452	hsa-miR-211-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24039954
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	24220575
MIRT054486	hsa-miR-655-3p	Luciferase reporter assay/Western blotqRT-PCR	23690952
MIRT054486	hsa-miR-655-3p	Luciferase reporter assay/Western blotqRT-PCR	23690952
MIRT027974	hsa-miR-93-5p	ELISAImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24606633
MIRT053652	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	23986572
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCR	25024357
MIRT053652	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	23986572
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCR	25024357
MIRT717796	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT717795	hsa-miR-5688	HITS-CLIP	19536157
MIRT717794	hsa-miR-570-3p	HITS-CLIP	19536157
MIRT717793	hsa-miR-606	HITS-CLIP	19536157
MIRT717792	hsa-miR-7849-3p	HITS-CLIP	19536157
MIRT717791	hsa-miR-3200-5p	HITS-CLIP	19536157
MIRT717790	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT717789	hsa-miR-4649-3p	HITS-CLIP	19536157
MIRT717788	hsa-miR-7162-3p	HITS-CLIP	19536157
MIRT717787	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT717786	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT712131	hsa-miR-548u	HITS-CLIP	19536157
MIRT712130	hsa-miR-7161-5p	HITS-CLIP	19536157
MIRT712129	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT712128	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT712127	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT712126	hsa-miR-488-3p	HITS-CLIP	19536157
MIRT608136	hsa-miR-6758-5p	HITS-CLIP	24906430
MIRT608135	hsa-miR-6856-5p	HITS-CLIP	24906430
MIRT608134	hsa-miR-6832-5p	HITS-CLIP	24906430
MIRT608133	hsa-miR-4732-5p	HITS-CLIP	24906430
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608132	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608130	hsa-miR-147a	HITS-CLIP	24906430
MIRT608129	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT091700	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT091702	hsa-miR-4295	PAR-CLIP	20371350
MIRT091703	hsa-miR-3666	PAR-CLIP	20371350
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT004591	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT027974	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT091688	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT091699	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT533838	hsa-miR-3609	PAR-CLIP	20371350
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT162322	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT091697	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT091694	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT091692	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT162313	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT091700	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT091702	hsa-miR-4295	PAR-CLIP	21572407
MIRT091703	hsa-miR-3666	PAR-CLIP	21572407
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT004591	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT027974	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT091688	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT533838	hsa-miR-3609	PAR-CLIP	21572407
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT533835	hsa-miR-4438	PAR-CLIP	21572407
MIRT553665	hsa-miR-4324	PAR-CLIP	21572407
MIRT162326	hsa-miR-544b	PAR-CLIP	21572407
MIRT162335	hsa-miR-6758-3p	PAR-CLIP	21572407
MIRT162333	hsa-miR-5095	PAR-CLIP	21572407
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT553664	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT553663	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT553662	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT162323	hsa-miR-1200	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT091700	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT091702	hsa-miR-4295	PAR-CLIP	21572407
MIRT091703	hsa-miR-3666	PAR-CLIP	21572407
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT004591	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT027974	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT091688	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT091699	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT533838	hsa-miR-3609	PAR-CLIP	21572407
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT091697	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT091694	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT091692	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT533835	hsa-miR-4438	PAR-CLIP	21572407
MIRT162333	hsa-miR-5095	PAR-CLIP	21572407
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT091700	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT091702	hsa-miR-4295	PAR-CLIP	22012620
MIRT091703	hsa-miR-3666	PAR-CLIP	22012620
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT004591	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT027974	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT091688	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT533838	hsa-miR-3609	PAR-CLIP	22012620
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT533835	hsa-miR-4438	PAR-CLIP	22012620
MIRT162333	hsa-miR-5095	PAR-CLIP	22012620
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT091712	hsa-miR-1276	PAR-CLIP	22012620
MIRT243467	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT307056	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT307058	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT307008	hsa-miR-6808-5p	PAR-CLIP	22012620
MIRT307010	hsa-miR-6893-5p	PAR-CLIP	22012620
MIRT307002	hsa-miR-940	PAR-CLIP	22012620
MIRT307057	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT053287	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT307054	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT243469	hsa-miR-610	PAR-CLIP	22012620
MIRT307050	hsa-miR-34a-5p	PAR-CLIP	22012620
MIRT307051	hsa-miR-34c-5p	PAR-CLIP	22012620
MIRT307052	hsa-miR-449a	PAR-CLIP	22012620
MIRT307053	hsa-miR-449b-5p	PAR-CLIP	22012620
MIRT307060	hsa-miR-6806-5p	PAR-CLIP	22012620
MIRT466406	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT466405	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT243470	hsa-miR-3978	PAR-CLIP	22012620
MIRT091712	hsa-miR-1276	PAR-CLIP	23592263
MIRT466407	hsa-miR-595	PAR-CLIP	23592263
MIRT243468	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT243467	hsa-miR-33a-3p	PAR-CLIP	23592263
MIRT307055	hsa-miR-1253	PAR-CLIP	23592263
MIRT307059	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT243469	hsa-miR-610	PAR-CLIP	23592263
MIRT370849	hsa-miR-1827	PAR-CLIP	23592263
MIRT370850	hsa-miR-4316	PAR-CLIP	23592263
MIRT466406	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT466405	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT091689	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT001785	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT091689	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT004591	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT091691	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT027974	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT091695	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT004593	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT004594	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT001785	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT004591	hsa-miR-17-5p	qRT-PCRLuciferase reporter assayWestern blot	25011053
MIRT053652	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayImmunoblotWestern blot	25323858
MIRT053652	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayImmunoblotWestern blot	25323858
MIRT053652	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayImmunoblotWestern blot	25323858
MIRT053652	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayImmunoblotWestern blot	25323858
MIRT004593	hsa-miR-19a-3p	qRT-PCRLuciferase reporter assayWestern blot	25443138
MIRT004591	hsa-miR-17-5p	Luciferase reporter assay	27120811
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	27080303
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	27080303
MIRT001785	hsa-miR-20a-5p	Luciferase reporter assay	27080303
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	27098600
MIRT004594	hsa-miR-19b-3p	Luciferase reporter assay	27098600
MIRT091688	hsa-miR-142-5p	Luciferase reporter assayqRT-PCRWestern blot	26572508
MIRT091688	hsa-miR-142-5p	Luciferase reporter assayqRT-PCRWestern blot	26572508
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	27756824
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	27756824
MIRT004591	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27120811
MIRT004591	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27120811
MIRT091687	hsa-miR-130a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27304191
MIRT091687	hsa-miR-130a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27304191
MIRT053301	hsa-miR-373-3p	PC3	25980442
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	28131417
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	28131417
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	28131417
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	28131417
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	28131417
MIRT004591	hsa-miR-17-5p	ImmunoblotImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	27508097
MIRT004591	hsa-miR-17-5p	ImmunoblotImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	27508097
MIRT001785	hsa-miR-20a-5p	ImmunoblotImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	27508097
MIRT001785	hsa-miR-20a-5p	ImmunoblotImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	27508097
MIRT001785	hsa-miR-20a-5p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	26729221
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	Luciferase reporter assayqRT-PCRWestern blot	26315535
MIRT438536	hsa-miR-9-5p	qRT-PCRWestern blot	27274768
MIRT438536	hsa-miR-9-5p	qRT-PCRWestern blot	27274768
MIRT438536	hsa-miR-9-5p	qRT-PCRWestern blot	27274768
MIRT438536	hsa-miR-9-5p	qRT-PCRWestern blot	27274768
MIRT438536	hsa-miR-9-5p	qRT-PCRWestern blot	27274768
MIRT004594	hsa-miR-19b-3p	Luciferase reporter assayqRT-PCRWestern blot	28083843
MIRT053652	hsa-miR-145-5p	Luciferase reporter assay	27388239
MIRT001189	hsa-miR-21-5p	Luciferase reporter assay	27388239
MIRT608130	hsa-miR-147a	HITS-CLIP	27418678
MIRT608130	hsa-miR-147a	HITS-CLIP	27418678
MIRT608130	hsa-miR-147a	HITS-CLIP	27418678
MIRT608133	hsa-miR-4732-5p	HITS-CLIP	27418678
MIRT608133	hsa-miR-4732-5p	HITS-CLIP	27418678
MIRT608133	hsa-miR-4732-5p	HITS-CLIP	27418678
MIRT608129	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608129	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608129	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608129	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608129	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608136	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT608136	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT608136	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT608132	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608132	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608132	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608134	hsa-miR-6832-5p	HITS-CLIP	27418678
MIRT608134	hsa-miR-6832-5p	HITS-CLIP	27418678
MIRT608134	hsa-miR-6832-5p	HITS-CLIP	27418678
MIRT608135	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT608135	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT608135	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT732728	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blotting	33070258
MIRT732968	hsa-miR-155-3p	Luciferase reporter assayqRT-PCRWestern blotting	33500705
MIRT732968	hsa-miR-155-3p	Luciferase reporter assayqRT-PCRWestern blotting	33500705
MIRT053301	hsa-miR-373-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33955122
MIRT053301	hsa-miR-373-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33955122
MIRT053301	hsa-miR-373-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33955122
MIRT030358	hsa-miR-26a-5p	ELISAImmunoprecipitaion (IP)Luciferase reporter assayWestern blotting	33857357
MIRT734420	hsa-miR-411-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	34169675
MIRT001785	hsa-miR-20a-5p	ELISAFACSImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32117757
MIRT001785	hsa-miR-20a-5p	ELISAFACSImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	32117757
MIRT735109	hsa-miR-320a	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	33430962
MIRT438536	hsa-miR-9-5p	Western blottingqRT-PCR	32612392
MIRT735926	hsa-miR-587	Luciferase reporter assayWestern blottingqRT-PCR	31721529
MIRT027974	hsa-miR-93-5p	Luciferase reporter assayRNA-seqELISA	32849363
MIRT027974	hsa-miR-93-5p	Luciferase reporter assayWestern blottingqRT-PCR	33448310
MIRT004594	hsa-miR-19b-3p	Luciferase reporter assayWestern blottingFlow cytometry	31591389
MIRT732968	hsa-miR-155-3p	Luciferase reporter assayWestern blottingqRT-PCR	33500705
MIRT735109	hsa-miR-320a	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceqRT-PCR	33430962
MIRT001785	hsa-miR-20a-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCRELISA	32117757
MIRT717796	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT717795	hsa-miR-5688	HITS-CLIP	19536157
MIRT717794	hsa-miR-570-3p	HITS-CLIP	19536157
MIRT717793	hsa-miR-606	HITS-CLIP	19536157
MIRT717792	hsa-miR-7849-3p	HITS-CLIP	19536157
MIRT717791	hsa-miR-3200-5p	HITS-CLIP	19536157
MIRT717790	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT717789	hsa-miR-4649-3p	HITS-CLIP	19536157
MIRT717788	hsa-miR-7162-3p	HITS-CLIP	19536157
MIRT717787	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT717786	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT712131	hsa-miR-548u	HITS-CLIP	19536157
MIRT712130	hsa-miR-7161-5p	HITS-CLIP	19536157
MIRT712129	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT712128	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT712127	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT712126	hsa-miR-488-3p	HITS-CLIP	19536157
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT091700	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT091702	hsa-miR-4295	PAR-CLIP	20371350
MIRT091703	hsa-miR-3666	PAR-CLIP	20371350
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT004591	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT027974	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT091688	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT091699	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT533838	hsa-miR-3609	PAR-CLIP	20371350
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT162322	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT091697	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT091694	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT091692	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT162313	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT091700	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT091702	hsa-miR-4295	PAR-CLIP	21572407
MIRT091703	hsa-miR-3666	PAR-CLIP	21572407
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT004591	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT027974	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT091688	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT533838	hsa-miR-3609	PAR-CLIP	21572407
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT533835	hsa-miR-4438	PAR-CLIP	21572407
MIRT553665	hsa-miR-4324	PAR-CLIP	21572407
MIRT162326	hsa-miR-544b	PAR-CLIP	21572407
MIRT162335	hsa-miR-6758-3p	PAR-CLIP	21572407
MIRT162333	hsa-miR-5095	PAR-CLIP	21572407
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT553664	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT553663	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT553662	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT162323	hsa-miR-1200	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT091700	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT091702	hsa-miR-4295	PAR-CLIP	21572407
MIRT091703	hsa-miR-3666	PAR-CLIP	21572407
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT004591	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT027974	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT091688	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT091699	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT533838	hsa-miR-3609	PAR-CLIP	21572407
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT091697	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT091694	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT091692	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT533835	hsa-miR-4438	PAR-CLIP	21572407
MIRT162333	hsa-miR-5095	PAR-CLIP	21572407
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT091700	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT091702	hsa-miR-4295	PAR-CLIP	22012620
MIRT091703	hsa-miR-3666	PAR-CLIP	22012620
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT004591	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT027974	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT091688	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT533838	hsa-miR-3609	PAR-CLIP	22012620
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT533835	hsa-miR-4438	PAR-CLIP	22012620
MIRT162333	hsa-miR-5095	PAR-CLIP	22012620
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT091712	hsa-miR-1276	PAR-CLIP	22012620
MIRT243467	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT307056	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT307058	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT307008	hsa-miR-6808-5p	PAR-CLIP	22012620
MIRT307010	hsa-miR-6893-5p	PAR-CLIP	22012620
MIRT307002	hsa-miR-940	PAR-CLIP	22012620
MIRT307057	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT053287	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT307054	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT243469	hsa-miR-610	PAR-CLIP	22012620
MIRT307050	hsa-miR-34a-5p	PAR-CLIP	22012620
MIRT307051	hsa-miR-34c-5p	PAR-CLIP	22012620
MIRT307052	hsa-miR-449a	PAR-CLIP	22012620
MIRT307053	hsa-miR-449b-5p	PAR-CLIP	22012620
MIRT307060	hsa-miR-6806-5p	PAR-CLIP	22012620
MIRT466406	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT466405	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT243470	hsa-miR-3978	PAR-CLIP	22012620
MIRT091712	hsa-miR-1276	PAR-CLIP	23592263
MIRT466407	hsa-miR-595	PAR-CLIP	23592263
MIRT243468	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT243467	hsa-miR-33a-3p	PAR-CLIP	23592263
MIRT307055	hsa-miR-1253	PAR-CLIP	23592263
MIRT307059	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT243469	hsa-miR-610	PAR-CLIP	23592263
MIRT370849	hsa-miR-1827	PAR-CLIP	23592263
MIRT370850	hsa-miR-4316	PAR-CLIP	23592263
MIRT466406	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT466405	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT755593	miR-145-5p	Western blottingELISA	36147907
MIRT004591	hsa-miR-17-5p	Luciferase reporter assayWestern blottingqRT-PCR	37024636
MIRT756265	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingqRT-PCR	38372101
MIRT053301	hsa-miR-373-3p	Luciferase reporter assayqRT-PCR	34643247
MIRT734420	hsa-miR-411-5p	Luciferase reporter assayWestern blottingqRT-PCR	34169675
MIRT1421424	hsa-miR-1273e	CLIP-seq
MIRT1421425	hsa-miR-1279	CLIP-seq
MIRT1421426	hsa-miR-1912	CLIP-seq
MIRT1421427	hsa-miR-196a	CLIP-seq
MIRT1421428	hsa-miR-196b	CLIP-seq
MIRT1421429	hsa-miR-302a	CLIP-seq
MIRT1421430	hsa-miR-302b	CLIP-seq
MIRT1421431	hsa-miR-302c	CLIP-seq
MIRT1421432	hsa-miR-302d	CLIP-seq
MIRT1421433	hsa-miR-302e	CLIP-seq
MIRT1421434	hsa-miR-3130-5p	CLIP-seq
MIRT1421435	hsa-miR-3672	CLIP-seq
MIRT1421436	hsa-miR-372	CLIP-seq
MIRT1421437	hsa-miR-373	CLIP-seq
MIRT1421438	hsa-miR-4482	CLIP-seq
MIRT1421439	hsa-miR-4698	CLIP-seq
MIRT1421440	hsa-miR-519a	CLIP-seq
MIRT1421441	hsa-miR-520b	CLIP-seq
MIRT1421442	hsa-miR-520c-3p	CLIP-seq
MIRT1421443	hsa-miR-520d-3p	CLIP-seq
MIRT1421444	hsa-miR-520e	CLIP-seq
MIRT1421445	hsa-miR-520f	CLIP-seq
MIRT1421446	hsa-miR-548ag	CLIP-seq
MIRT1421447	hsa-miR-548ai	CLIP-seq
MIRT1421448	hsa-miR-636	CLIP-seq
MIRT1421449	hsa-miR-656	CLIP-seq
MIRT1421450	hsa-miR-106a	CLIP-seq
MIRT1421451	hsa-miR-106b	CLIP-seq
MIRT1421452	hsa-miR-1270	CLIP-seq
MIRT1421453	hsa-miR-1273d	CLIP-seq
MIRT1421425	hsa-miR-1279	CLIP-seq
MIRT1421454	hsa-miR-1303	CLIP-seq
MIRT1421455	hsa-miR-130a	CLIP-seq
MIRT1421456	hsa-miR-130b	CLIP-seq
MIRT1421457	hsa-miR-145	CLIP-seq
MIRT1421458	hsa-miR-17	CLIP-seq
MIRT1421459	hsa-miR-181a	CLIP-seq
MIRT1421460	hsa-miR-181b	CLIP-seq
MIRT1421461	hsa-miR-181c	CLIP-seq
MIRT1421462	hsa-miR-181d	CLIP-seq
MIRT1421463	hsa-miR-19a	CLIP-seq
MIRT1421464	hsa-miR-19b	CLIP-seq
MIRT1421465	hsa-miR-20a	CLIP-seq
MIRT1421466	hsa-miR-20b	CLIP-seq
MIRT1421467	hsa-miR-301a	CLIP-seq
MIRT1421468	hsa-miR-301b	CLIP-seq
MIRT1421469	hsa-miR-3074-5p	CLIP-seq
MIRT1421470	hsa-miR-3117-5p	CLIP-seq
MIRT1421471	hsa-miR-3180-5p	CLIP-seq
MIRT1421472	hsa-miR-3591-3p	CLIP-seq
MIRT1421473	hsa-miR-3671	CLIP-seq
MIRT1421474	hsa-miR-4262	CLIP-seq
MIRT1421475	hsa-miR-4272	CLIP-seq
MIRT1421476	hsa-miR-4307	CLIP-seq
MIRT1421477	hsa-miR-450b-5p	CLIP-seq
MIRT1421478	hsa-miR-454	CLIP-seq
MIRT1421479	hsa-miR-4540	CLIP-seq
MIRT1421480	hsa-miR-4683	CLIP-seq
MIRT1421481	hsa-miR-4686	CLIP-seq
MIRT1421482	hsa-miR-4711-5p	CLIP-seq
MIRT1421483	hsa-miR-4713-3p	CLIP-seq
MIRT1421484	hsa-miR-4728-3p	CLIP-seq
MIRT1421485	hsa-miR-4753-5p	CLIP-seq
MIRT1421486	hsa-miR-4762-5p	CLIP-seq
MIRT1421487	hsa-miR-491-3p	CLIP-seq
MIRT1421488	hsa-miR-507	CLIP-seq
MIRT1421489	hsa-miR-515-3p	CLIP-seq
MIRT1421490	hsa-miR-518a-5p	CLIP-seq
MIRT1421440	hsa-miR-519a	CLIP-seq
MIRT1421491	hsa-miR-519d	CLIP-seq
MIRT1421492	hsa-miR-519e	CLIP-seq
MIRT1421493	hsa-miR-527	CLIP-seq
MIRT1421494	hsa-miR-548aa	CLIP-seq
MIRT1421495	hsa-miR-548ah	CLIP-seq
MIRT1421496	hsa-miR-550a	CLIP-seq
MIRT1421497	hsa-miR-557	CLIP-seq
MIRT1421498	hsa-miR-570	CLIP-seq
MIRT1421499	hsa-miR-607	CLIP-seq
MIRT1421500	hsa-miR-620	CLIP-seq
MIRT1421501	hsa-miR-628-5p	CLIP-seq
MIRT1421502	hsa-miR-665	CLIP-seq
MIRT1421503	hsa-miR-93	CLIP-seq
MIRT1557179	hsa-miR-9	CLIP-seq
MIRT2126412	hsa-miR-1269	CLIP-seq
MIRT2126413	hsa-miR-1269b	CLIP-seq
MIRT1421452	hsa-miR-1270	CLIP-seq
MIRT1421424	hsa-miR-1273e	CLIP-seq
MIRT2126414	hsa-miR-1288	CLIP-seq
MIRT2126415	hsa-miR-21	CLIP-seq
MIRT2126416	hsa-miR-216a	CLIP-seq
MIRT1421469	hsa-miR-3074-5p	CLIP-seq
MIRT2126417	hsa-miR-3127-5p	CLIP-seq
MIRT2126418	hsa-miR-323b-3p	CLIP-seq
MIRT2126419	hsa-miR-370	CLIP-seq
MIRT2126420	hsa-miR-3919	CLIP-seq
MIRT2126421	hsa-miR-4277	CLIP-seq
MIRT2126422	hsa-miR-4515	CLIP-seq
MIRT2126423	hsa-miR-4653-3p	CLIP-seq
MIRT1421480	hsa-miR-4683	CLIP-seq
MIRT2126424	hsa-miR-4688	CLIP-seq
MIRT2126425	hsa-miR-4740-5p	CLIP-seq
MIRT2126426	hsa-miR-486-3p	CLIP-seq
MIRT2126427	hsa-miR-516a-3p	CLIP-seq
MIRT1421494	hsa-miR-548aa	CLIP-seq
MIRT1421498	hsa-miR-570	CLIP-seq
MIRT1421500	hsa-miR-620	CLIP-seq
MIRT1557179	hsa-miR-9	CLIP-seq
MIRT1421453	hsa-miR-1273d	CLIP-seq
MIRT1421455	hsa-miR-130a	CLIP-seq
MIRT1421456	hsa-miR-130b	CLIP-seq
MIRT1421457	hsa-miR-145	CLIP-seq
MIRT1421459	hsa-miR-181a	CLIP-seq
MIRT1421460	hsa-miR-181b	CLIP-seq
MIRT1421461	hsa-miR-181c	CLIP-seq
MIRT1421462	hsa-miR-181d	CLIP-seq
MIRT1421426	hsa-miR-1912	CLIP-seq
MIRT2348455	hsa-miR-23a	CLIP-seq
MIRT2348456	hsa-miR-23b	CLIP-seq
MIRT2348457	hsa-miR-23c	CLIP-seq
MIRT1421467	hsa-miR-301a	CLIP-seq
MIRT1421468	hsa-miR-301b	CLIP-seq
MIRT1421429	hsa-miR-302a	CLIP-seq
MIRT1421430	hsa-miR-302b	CLIP-seq
MIRT1421431	hsa-miR-302c	CLIP-seq
MIRT1421432	hsa-miR-302d	CLIP-seq
MIRT1421433	hsa-miR-302e	CLIP-seq
MIRT1421469	hsa-miR-3074-5p	CLIP-seq
MIRT1421471	hsa-miR-3180-5p	CLIP-seq
MIRT1421436	hsa-miR-372	CLIP-seq
MIRT1421437	hsa-miR-373	CLIP-seq
MIRT2348458	hsa-miR-3915	CLIP-seq
MIRT2348459	hsa-miR-3928	CLIP-seq
MIRT1421474	hsa-miR-4262	CLIP-seq
MIRT1421478	hsa-miR-454	CLIP-seq
MIRT2348460	hsa-miR-4635	CLIP-seq
MIRT1421484	hsa-miR-4728-3p	CLIP-seq
MIRT1421487	hsa-miR-491-3p	CLIP-seq
MIRT1421440	hsa-miR-519a	CLIP-seq
MIRT1421441	hsa-miR-520b	CLIP-seq
MIRT1421442	hsa-miR-520c-3p	CLIP-seq
MIRT1421443	hsa-miR-520d-3p	CLIP-seq
MIRT1421444	hsa-miR-520e	CLIP-seq
MIRT1421494	hsa-miR-548aa	CLIP-seq
MIRT2348461	hsa-miR-580	CLIP-seq
MIRT1421502	hsa-miR-665	CLIP-seq
MIRT1421453	hsa-miR-1273d	CLIP-seq
MIRT1421457	hsa-miR-145	CLIP-seq
MIRT1421459	hsa-miR-181a	CLIP-seq
MIRT1421460	hsa-miR-181b	CLIP-seq
MIRT1421461	hsa-miR-181c	CLIP-seq
MIRT1421462	hsa-miR-181d	CLIP-seq
MIRT2395720	hsa-miR-1911	CLIP-seq
MIRT1421426	hsa-miR-1912	CLIP-seq
MIRT2126415	hsa-miR-21	CLIP-seq
MIRT1421470	hsa-miR-3117-5p	CLIP-seq
MIRT2395721	hsa-miR-3616-5p	CLIP-seq
MIRT2395722	hsa-miR-3647-5p	CLIP-seq
MIRT2395723	hsa-miR-3660	CLIP-seq
MIRT2395724	hsa-miR-374c	CLIP-seq
MIRT2395725	hsa-miR-3910	CLIP-seq
MIRT2395726	hsa-miR-425	CLIP-seq
MIRT1421474	hsa-miR-4262	CLIP-seq
MIRT2395727	hsa-miR-4526	CLIP-seq
MIRT2348460	hsa-miR-4635	CLIP-seq
MIRT1421484	hsa-miR-4728-3p	CLIP-seq
MIRT2395728	hsa-miR-4795-5p	CLIP-seq
MIRT2126426	hsa-miR-486-3p	CLIP-seq
MIRT1421487	hsa-miR-491-3p	CLIP-seq
MIRT2395729	hsa-miR-548an	CLIP-seq
MIRT2395730	hsa-miR-573	CLIP-seq
MIRT2348461	hsa-miR-580	CLIP-seq
MIRT2395731	hsa-miR-655	CLIP-seq
MIRT2440986	hsa-miR-1228	CLIP-seq
MIRT2126412	hsa-miR-1269	CLIP-seq
MIRT2126413	hsa-miR-1269b	CLIP-seq
MIRT1421452	hsa-miR-1270	CLIP-seq
MIRT2126414	hsa-miR-1288	CLIP-seq
MIRT2440987	hsa-miR-1321	CLIP-seq
MIRT1421457	hsa-miR-145	CLIP-seq
MIRT1421459	hsa-miR-181a	CLIP-seq
MIRT1421460	hsa-miR-181b	CLIP-seq
MIRT1421461	hsa-miR-181c	CLIP-seq
MIRT1421462	hsa-miR-181d	CLIP-seq
MIRT2126415	hsa-miR-21	CLIP-seq
MIRT2440988	hsa-miR-2113	CLIP-seq
MIRT2440989	hsa-miR-2116	CLIP-seq
MIRT2348455	hsa-miR-23a	CLIP-seq
MIRT2348456	hsa-miR-23b	CLIP-seq
MIRT2348457	hsa-miR-23c	CLIP-seq
MIRT1421469	hsa-miR-3074-5p	CLIP-seq
MIRT1421470	hsa-miR-3117-5p	CLIP-seq
MIRT2440990	hsa-miR-3127-3p	CLIP-seq
MIRT2126417	hsa-miR-3127-5p	CLIP-seq
MIRT2440991	hsa-miR-3136-3p	CLIP-seq
MIRT2440992	hsa-miR-3163	CLIP-seq
MIRT1421471	hsa-miR-3180-5p	CLIP-seq
MIRT2440993	hsa-miR-3184	CLIP-seq
MIRT2126418	hsa-miR-323b-3p	CLIP-seq
MIRT2440994	hsa-miR-3611	CLIP-seq
MIRT1421435	hsa-miR-3672	CLIP-seq
MIRT2126419	hsa-miR-370	CLIP-seq
MIRT2395725	hsa-miR-3910	CLIP-seq
MIRT2440995	hsa-miR-423-5p	CLIP-seq
MIRT2395726	hsa-miR-425	CLIP-seq
MIRT1421474	hsa-miR-4262	CLIP-seq
MIRT2440996	hsa-miR-4270	CLIP-seq
MIRT2126421	hsa-miR-4277	CLIP-seq
MIRT2440997	hsa-miR-4441	CLIP-seq
MIRT2126422	hsa-miR-4515	CLIP-seq
MIRT2440998	hsa-miR-4520a-3p	CLIP-seq
MIRT2440999	hsa-miR-4520b-3p	CLIP-seq
MIRT2441000	hsa-miR-4529-3p	CLIP-seq
MIRT1421479	hsa-miR-4540	CLIP-seq
MIRT2441001	hsa-miR-4640-3p	CLIP-seq
MIRT2441002	hsa-miR-4677-5p	CLIP-seq
MIRT1421480	hsa-miR-4683	CLIP-seq
MIRT2126424	hsa-miR-4688	CLIP-seq
MIRT2441003	hsa-miR-4710	CLIP-seq
MIRT1421482	hsa-miR-4711-5p	CLIP-seq
MIRT1421484	hsa-miR-4728-3p	CLIP-seq
MIRT2441004	hsa-miR-4728-5p	CLIP-seq
MIRT2441005	hsa-miR-4739	CLIP-seq
MIRT2126425	hsa-miR-4740-5p	CLIP-seq
MIRT2441006	hsa-miR-4756-5p	CLIP-seq
MIRT2441007	hsa-miR-4786-5p	CLIP-seq
MIRT2441008	hsa-miR-4792	CLIP-seq
MIRT2126426	hsa-miR-486-3p	CLIP-seq
MIRT1421487	hsa-miR-491-3p	CLIP-seq
MIRT2126427	hsa-miR-516a-3p	CLIP-seq
MIRT2441009	hsa-miR-544	CLIP-seq
MIRT2395729	hsa-miR-548an	CLIP-seq
MIRT1421498	hsa-miR-570	CLIP-seq
MIRT2441010	hsa-miR-600	CLIP-seq
MIRT1421500	hsa-miR-620	CLIP-seq
MIRT1421502	hsa-miR-665	CLIP-seq
MIRT2441011	hsa-miR-758	CLIP-seq
MIRT2441012	hsa-miR-769-5p	CLIP-seq
MIRT1557179	hsa-miR-9	CLIP-seq
MIRT2126415	hsa-miR-21	CLIP-seq
MIRT2395725	hsa-miR-3910	CLIP-seq
MIRT2395726	hsa-miR-425	CLIP-seq
MIRT2395729	hsa-miR-548an	CLIP-seq
MIRT2641229	hsa-miR-1179	CLIP-seq
MIRT2641230	hsa-miR-1193	CLIP-seq
MIRT2641231	hsa-miR-1208	CLIP-seq
MIRT2440986	hsa-miR-1228	CLIP-seq
MIRT2641232	hsa-miR-1229	CLIP-seq
MIRT2641233	hsa-miR-1238	CLIP-seq
MIRT2641234	hsa-miR-1244	CLIP-seq
MIRT2126412	hsa-miR-1269	CLIP-seq
MIRT2126413	hsa-miR-1269b	CLIP-seq
MIRT1421453	hsa-miR-1273d	CLIP-seq
MIRT1421424	hsa-miR-1273e	CLIP-seq
MIRT1421425	hsa-miR-1279	CLIP-seq
MIRT2126414	hsa-miR-1288	CLIP-seq
MIRT1421457	hsa-miR-145	CLIP-seq
MIRT1421459	hsa-miR-181a	CLIP-seq
MIRT1421460	hsa-miR-181b	CLIP-seq
MIRT1421461	hsa-miR-181c	CLIP-seq
MIRT1421462	hsa-miR-181d	CLIP-seq
MIRT2641235	hsa-miR-186	CLIP-seq
MIRT2395720	hsa-miR-1911	CLIP-seq
MIRT1421426	hsa-miR-1912	CLIP-seq
MIRT1421427	hsa-miR-196a	CLIP-seq
MIRT1421428	hsa-miR-196b	CLIP-seq
MIRT2641236	hsa-miR-197	CLIP-seq
MIRT2641237	hsa-miR-1972	CLIP-seq
MIRT2641238	hsa-miR-203	CLIP-seq
MIRT2641239	hsa-miR-204	CLIP-seq
MIRT2126415	hsa-miR-21	CLIP-seq
MIRT2641240	hsa-miR-211	CLIP-seq
MIRT2440988	hsa-miR-2113	CLIP-seq
MIRT2641241	hsa-miR-218	CLIP-seq
MIRT2348455	hsa-miR-23a	CLIP-seq
MIRT2348456	hsa-miR-23b	CLIP-seq
MIRT2348457	hsa-miR-23c	CLIP-seq
MIRT1421470	hsa-miR-3117-5p	CLIP-seq
MIRT2641242	hsa-miR-3123	CLIP-seq
MIRT2641243	hsa-miR-3124-3p	CLIP-seq
MIRT2440990	hsa-miR-3127-3p	CLIP-seq
MIRT1421434	hsa-miR-3130-5p	CLIP-seq
MIRT2641244	hsa-miR-3145-3p	CLIP-seq
MIRT2641245	hsa-miR-3149	CLIP-seq
MIRT2641246	hsa-miR-3160-3p	CLIP-seq
MIRT2440992	hsa-miR-3163	CLIP-seq
MIRT2126418	hsa-miR-323b-3p	CLIP-seq
MIRT2641247	hsa-miR-337-3p	CLIP-seq
MIRT1421472	hsa-miR-3591-3p	CLIP-seq
MIRT2641248	hsa-miR-3606	CLIP-seq
MIRT2440994	hsa-miR-3611	CLIP-seq
MIRT2395721	hsa-miR-3616-5p	CLIP-seq
MIRT2641249	hsa-miR-3619-3p	CLIP-seq
MIRT2395722	hsa-miR-3647-5p	CLIP-seq
MIRT1421473	hsa-miR-3671	CLIP-seq
MIRT1421435	hsa-miR-3672	CLIP-seq
MIRT2395724	hsa-miR-374c	CLIP-seq
MIRT2395725	hsa-miR-3910	CLIP-seq
MIRT2641250	hsa-miR-3914	CLIP-seq
MIRT2126420	hsa-miR-3919	CLIP-seq
MIRT2641251	hsa-miR-3924	CLIP-seq
MIRT2641252	hsa-miR-3925-5p	CLIP-seq
MIRT2641253	hsa-miR-3926	CLIP-seq
MIRT2395726	hsa-miR-425	CLIP-seq
MIRT2641254	hsa-miR-4255	CLIP-seq
MIRT1421474	hsa-miR-4262	CLIP-seq
MIRT2641255	hsa-miR-4420	CLIP-seq
MIRT2641256	hsa-miR-4426	CLIP-seq
MIRT2641257	hsa-miR-4433	CLIP-seq
MIRT2641258	hsa-miR-4446-5p	CLIP-seq
MIRT2641259	hsa-miR-4459	CLIP-seq
MIRT2641260	hsa-miR-4475	CLIP-seq
MIRT1421438	hsa-miR-4482	CLIP-seq
MIRT2641261	hsa-miR-450b-3p	CLIP-seq
MIRT2126422	hsa-miR-4515	CLIP-seq
MIRT2641262	hsa-miR-452	CLIP-seq
MIRT1421479	hsa-miR-4540	CLIP-seq
MIRT2348460	hsa-miR-4635	CLIP-seq
MIRT2641263	hsa-miR-4647	CLIP-seq
MIRT2641264	hsa-miR-4650-5p	CLIP-seq
MIRT2641265	hsa-miR-4662b	CLIP-seq
MIRT2641266	hsa-miR-4676-3p	CLIP-seq
MIRT2641267	hsa-miR-4694-5p	CLIP-seq
MIRT1421439	hsa-miR-4698	CLIP-seq
MIRT2641268	hsa-miR-4703-3p	CLIP-seq
MIRT1421484	hsa-miR-4728-3p	CLIP-seq
MIRT2126425	hsa-miR-4740-5p	CLIP-seq
MIRT1421485	hsa-miR-4753-5p	CLIP-seq
MIRT2641269	hsa-miR-4755-5p	CLIP-seq
MIRT2641270	hsa-miR-4756-3p	CLIP-seq
MIRT1421486	hsa-miR-4762-5p	CLIP-seq
MIRT2641271	hsa-miR-4768-3p	CLIP-seq
MIRT2641272	hsa-miR-4776-5p	CLIP-seq
MIRT2641273	hsa-miR-4777-5p	CLIP-seq
MIRT2441007	hsa-miR-4786-5p	CLIP-seq
MIRT2641274	hsa-miR-4790-3p	CLIP-seq
MIRT2395728	hsa-miR-4795-5p	CLIP-seq
MIRT2641275	hsa-miR-4802-3p	CLIP-seq
MIRT1421487	hsa-miR-491-3p	CLIP-seq
MIRT1421490	hsa-miR-518a-5p	CLIP-seq
MIRT2641276	hsa-miR-518d-5p	CLIP-seq
MIRT2641277	hsa-miR-519b-5p	CLIP-seq
MIRT2641278	hsa-miR-519c-5p	CLIP-seq
MIRT2641279	hsa-miR-520c-5p	CLIP-seq
MIRT2641280	hsa-miR-526a	CLIP-seq
MIRT1421493	hsa-miR-527	CLIP-seq
MIRT2641281	hsa-miR-548a-3p	CLIP-seq
MIRT1421446	hsa-miR-548ag	CLIP-seq
MIRT1421447	hsa-miR-548ai	CLIP-seq
MIRT2395729	hsa-miR-548an	CLIP-seq
MIRT2641282	hsa-miR-548e	CLIP-seq
MIRT2641283	hsa-miR-548f	CLIP-seq
MIRT2641284	hsa-miR-548g	CLIP-seq
MIRT2641285	hsa-miR-568	CLIP-seq
MIRT2395730	hsa-miR-573	CLIP-seq
MIRT2348461	hsa-miR-580	CLIP-seq
MIRT2641286	hsa-miR-589	CLIP-seq
MIRT2441010	hsa-miR-600	CLIP-seq
MIRT1421499	hsa-miR-607	CLIP-seq
MIRT2641287	hsa-miR-623	CLIP-seq
MIRT2641288	hsa-miR-624	CLIP-seq
MIRT1421448	hsa-miR-636	CLIP-seq
MIRT2641289	hsa-miR-651	CLIP-seq
MIRT2395731	hsa-miR-655	CLIP-seq
MIRT1421449	hsa-miR-656	CLIP-seq
MIRT2641290	hsa-miR-660	CLIP-seq
MIRT2441011	hsa-miR-758	CLIP-seq
MIRT2641291	hsa-miR-769-3p	CLIP-seq
MIRT2441012	hsa-miR-769-5p	CLIP-seq
MIRT2641229	hsa-miR-1179	CLIP-seq
MIRT2641230	hsa-miR-1193	CLIP-seq
MIRT2641231	hsa-miR-1208	CLIP-seq
MIRT2440986	hsa-miR-1228	CLIP-seq
MIRT2641232	hsa-miR-1229	CLIP-seq
MIRT2641233	hsa-miR-1238	CLIP-seq
MIRT2641234	hsa-miR-1244	CLIP-seq
MIRT2126412	hsa-miR-1269	CLIP-seq
MIRT2126413	hsa-miR-1269b	CLIP-seq
MIRT1421452	hsa-miR-1270	CLIP-seq
MIRT1421453	hsa-miR-1273d	CLIP-seq
MIRT1421424	hsa-miR-1273e	CLIP-seq
MIRT1421425	hsa-miR-1279	CLIP-seq
MIRT2126414	hsa-miR-1288	CLIP-seq
MIRT1421457	hsa-miR-145	CLIP-seq
MIRT1421459	hsa-miR-181a	CLIP-seq
MIRT1421460	hsa-miR-181b	CLIP-seq
MIRT1421461	hsa-miR-181c	CLIP-seq
MIRT1421462	hsa-miR-181d	CLIP-seq
MIRT2641235	hsa-miR-186	CLIP-seq
MIRT2395720	hsa-miR-1911	CLIP-seq
MIRT1421426	hsa-miR-1912	CLIP-seq
MIRT1421427	hsa-miR-196a	CLIP-seq
MIRT1421428	hsa-miR-196b	CLIP-seq
MIRT2641236	hsa-miR-197	CLIP-seq
MIRT2641237	hsa-miR-1972	CLIP-seq
MIRT2641238	hsa-miR-203	CLIP-seq
MIRT2641239	hsa-miR-204	CLIP-seq
MIRT2126415	hsa-miR-21	CLIP-seq
MIRT2641240	hsa-miR-211	CLIP-seq
MIRT2440988	hsa-miR-2113	CLIP-seq
MIRT2693019	hsa-miR-2114	CLIP-seq
MIRT2641241	hsa-miR-218	CLIP-seq
MIRT2348455	hsa-miR-23a	CLIP-seq
MIRT2348456	hsa-miR-23b	CLIP-seq
MIRT2348457	hsa-miR-23c	CLIP-seq
MIRT1421470	hsa-miR-3117-5p	CLIP-seq
MIRT2641242	hsa-miR-3123	CLIP-seq
MIRT2641243	hsa-miR-3124-3p	CLIP-seq
MIRT2440990	hsa-miR-3127-3p	CLIP-seq
MIRT1421434	hsa-miR-3130-5p	CLIP-seq
MIRT2641244	hsa-miR-3145-3p	CLIP-seq
MIRT2641245	hsa-miR-3149	CLIP-seq
MIRT2693020	hsa-miR-3157-3p	CLIP-seq
MIRT2641246	hsa-miR-3160-3p	CLIP-seq
MIRT2440992	hsa-miR-3163	CLIP-seq
MIRT2693021	hsa-miR-3183	CLIP-seq
MIRT2126418	hsa-miR-323b-3p	CLIP-seq
MIRT2641247	hsa-miR-337-3p	CLIP-seq
MIRT1421472	hsa-miR-3591-3p	CLIP-seq
MIRT2440994	hsa-miR-3611	CLIP-seq
MIRT2395721	hsa-miR-3616-5p	CLIP-seq
MIRT2641249	hsa-miR-3619-3p	CLIP-seq
MIRT2395722	hsa-miR-3647-5p	CLIP-seq
MIRT1421473	hsa-miR-3671	CLIP-seq
MIRT1421435	hsa-miR-3672	CLIP-seq
MIRT2395724	hsa-miR-374c	CLIP-seq
MIRT2395725	hsa-miR-3910	CLIP-seq
MIRT2126420	hsa-miR-3919	CLIP-seq
MIRT2641251	hsa-miR-3924	CLIP-seq
MIRT2641252	hsa-miR-3925-5p	CLIP-seq
MIRT2641253	hsa-miR-3926	CLIP-seq
MIRT2395726	hsa-miR-425	CLIP-seq
MIRT2693022	hsa-miR-4252	CLIP-seq
MIRT2641254	hsa-miR-4255	CLIP-seq
MIRT1421474	hsa-miR-4262	CLIP-seq
MIRT2693023	hsa-miR-4310	CLIP-seq
MIRT2641255	hsa-miR-4420	CLIP-seq
MIRT2641256	hsa-miR-4426	CLIP-seq
MIRT2641257	hsa-miR-4433	CLIP-seq
MIRT2693024	hsa-miR-4435	CLIP-seq
MIRT2641258	hsa-miR-4446-5p	CLIP-seq
MIRT2641259	hsa-miR-4459	CLIP-seq
MIRT1421438	hsa-miR-4482	CLIP-seq
MIRT2641261	hsa-miR-450b-3p	CLIP-seq
MIRT2126422	hsa-miR-4515	CLIP-seq
MIRT2641262	hsa-miR-452	CLIP-seq
MIRT1421479	hsa-miR-4540	CLIP-seq
MIRT2348460	hsa-miR-4635	CLIP-seq
MIRT2641263	hsa-miR-4647	CLIP-seq
MIRT2641264	hsa-miR-4650-5p	CLIP-seq
MIRT2641265	hsa-miR-4662b	CLIP-seq
MIRT2641266	hsa-miR-4676-3p	CLIP-seq
MIRT1421480	hsa-miR-4683	CLIP-seq
MIRT1421481	hsa-miR-4686	CLIP-seq
MIRT2641267	hsa-miR-4694-5p	CLIP-seq
MIRT1421439	hsa-miR-4698	CLIP-seq
MIRT2641268	hsa-miR-4703-3p	CLIP-seq
MIRT2693025	hsa-miR-4723-3p	CLIP-seq
MIRT1421484	hsa-miR-4728-3p	CLIP-seq
MIRT2126425	hsa-miR-4740-5p	CLIP-seq
MIRT1421485	hsa-miR-4753-5p	CLIP-seq
MIRT2641269	hsa-miR-4755-5p	CLIP-seq
MIRT2641270	hsa-miR-4756-3p	CLIP-seq
MIRT1421486	hsa-miR-4762-5p	CLIP-seq
MIRT2641271	hsa-miR-4768-3p	CLIP-seq
MIRT2641272	hsa-miR-4776-5p	CLIP-seq
MIRT2641273	hsa-miR-4777-5p	CLIP-seq
MIRT2441007	hsa-miR-4786-5p	CLIP-seq
MIRT2641274	hsa-miR-4790-3p	CLIP-seq
MIRT2395728	hsa-miR-4795-5p	CLIP-seq
MIRT2641275	hsa-miR-4802-3p	CLIP-seq
MIRT1421487	hsa-miR-491-3p	CLIP-seq
MIRT1421490	hsa-miR-518a-5p	CLIP-seq
MIRT2641276	hsa-miR-518d-5p	CLIP-seq
MIRT2641277	hsa-miR-519b-5p	CLIP-seq
MIRT2641278	hsa-miR-519c-5p	CLIP-seq
MIRT2641279	hsa-miR-520c-5p	CLIP-seq
MIRT2641280	hsa-miR-526a	CLIP-seq
MIRT1421493	hsa-miR-527	CLIP-seq
MIRT2641281	hsa-miR-548a-3p	CLIP-seq
MIRT1421494	hsa-miR-548aa	CLIP-seq
MIRT1421446	hsa-miR-548ag	CLIP-seq
MIRT1421447	hsa-miR-548ai	CLIP-seq
MIRT2395729	hsa-miR-548an	CLIP-seq
MIRT2641282	hsa-miR-548e	CLIP-seq
MIRT2641283	hsa-miR-548f	CLIP-seq
MIRT2641284	hsa-miR-548g	CLIP-seq
MIRT2641285	hsa-miR-568	CLIP-seq
MIRT1421498	hsa-miR-570	CLIP-seq
MIRT2395730	hsa-miR-573	CLIP-seq
MIRT2348461	hsa-miR-580	CLIP-seq
MIRT2641286	hsa-miR-589	CLIP-seq
MIRT2441010	hsa-miR-600	CLIP-seq
MIRT1421499	hsa-miR-607	CLIP-seq
MIRT1421500	hsa-miR-620	CLIP-seq
MIRT2641287	hsa-miR-623	CLIP-seq
MIRT2641288	hsa-miR-624	CLIP-seq
MIRT1421448	hsa-miR-636	CLIP-seq
MIRT2693026	hsa-miR-642a	CLIP-seq
MIRT2395731	hsa-miR-655	CLIP-seq
MIRT1421449	hsa-miR-656	CLIP-seq
MIRT2641290	hsa-miR-660	CLIP-seq
MIRT2441011	hsa-miR-758	CLIP-seq
MIRT2641291	hsa-miR-769-3p	CLIP-seq
MIRT2441012	hsa-miR-769-5p	CLIP-seq

Show/Hide all (10)

Transcription factor	Regulation	Reference
EGR1	Unknown	10982796
ETS1	Activation	14976186
ETS1	Unknown	10508522
ETV4	Unknown	14976186
EWSR1	Repression	10508522
FLI1	Activation	10508522
FLI1	Repression	10508522
HDAC2	Repression	19088080
KLF14	Repression	19088080
SP1	Unknown	10982796;11687969

170

Show/Hide all (170)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001568	Process	Blood vessel development	TAS	10092230
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	ISS
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001701	Process	In utero embryonic development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	28131417
GO:0001947	Process	Heart looping	IEA
GO:0001947	Process	Heart looping	ISS
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0002651	Process	Positive regulation of tolerance induction to self antigen	IEA
GO:0002651	Process	Positive regulation of tolerance induction to self antigen	ISS
GO:0002663	Process	Positive regulation of B cell tolerance induction	IEA
GO:0002663	Process	Positive regulation of B cell tolerance induction	ISS
GO:0002666	Process	Positive regulation of T cell tolerance induction	IEA
GO:0002666	Process	Positive regulation of T cell tolerance induction	ISS
GO:0003148	Process	Outflow tract septum morphogenesis	IEA
GO:0003148	Process	Outflow tract septum morphogenesis	ISS
GO:0003149	Process	Membranous septum morphogenesis	IEA
GO:0003149	Process	Membranous septum morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003180	Process	Aortic valve morphogenesis	IMP	20101701
GO:0003181	Process	Atrioventricular valve morphogenesis	IEA
GO:0003181	Process	Atrioventricular valve morphogenesis	ISS
GO:0003186	Process	Tricuspid valve morphogenesis	IEA
GO:0003186	Process	Tricuspid valve morphogenesis	ISS
GO:0003214	Process	Cardiac left ventricle morphogenesis	IEA
GO:0003214	Process	Cardiac left ventricle morphogenesis	ISS
GO:0003274	Process	Endocardial cushion fusion	IEA
GO:0003274	Process	Endocardial cushion fusion	ISS
GO:0003417	Process	Growth plate cartilage development	IEA
GO:0003430	Process	Growth plate cartilage chondrocyte growth	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IDA	12015308
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IEA
GO:0005024	Function	Transforming growth factor beta receptor activity	IBA
GO:0005024	Function	Transforming growth factor beta receptor activity	IC	1326540
GO:0005024	Function	Transforming growth factor beta receptor activity	IDA	7852346, 8635485, 12015308, 18453574
GO:0005024	Function	Transforming growth factor beta receptor activity	IEA
GO:0005024	Function	Transforming growth factor beta receptor activity	IMP	1333888
GO:0005026	Function	Transforming growth factor beta receptor activity, type II	IDA	7774578
GO:0005026	Function	Transforming growth factor beta receptor activity, type II	IEA
GO:0005515	Function	Protein binding	IPI	7852346, 8242742, 8555189, 8622651, 9865696, 11157754, 11278302, 11279102, 11483955, 11850637, 12015308, 15702480, 16530041, 18243111, 20856203, 20860622, 21054789, 21423151, 21441952, 21791611, 23178117, 23868260, 24263861, 32814053, 35443807
GO:0005524	Function	ATP binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	IDA	7852346
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	34568316
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25893292
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	18243111, 20207738
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	17878231
GO:0006915	Process	Apoptotic process	IDA	17471240
GO:0006915	Process	Apoptotic process	IEA
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IC	1326540
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	11157754, 18548003
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	1333888, 9311995, 12015308, 18453574
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	1333888, 11157754, 24606633, 28131417
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7761852
GO:0009410	Process	Response to xenobiotic stimulus	IDA	17878231
GO:0009897	Component	External side of plasma membrane	IDA	18453574
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	26459119
GO:0016020	Component	Membrane	IDA	7852346
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016361	Function	Activin receptor activity, type I	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0019209	Function	Kinase activator activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0032924	Process	Activin receptor signaling pathway	IBA
GO:0033993	Process	Response to lipid	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IBA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IDA	11157754
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	1333888
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IDA	11157754
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0035909	Process	Aorta morphogenesis	IMP	20101701
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0043235	Component	Receptor complex	IDA	7852346, 8774881, 11157754
GO:0043235	Component	Receptor complex	IEA
GO:0045121	Component	Membrane raft	IDA	25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0046332	Function	SMAD binding	IDA	11157754, 18453574
GO:0046332	Function	SMAD binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048179	Component	Activin receptor complex	IBA
GO:0048185	Function	Activin binding	IBA
GO:0048513	Process	Animal organ development	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	ISS
GO:0048844	Process	Artery morphogenesis	IMP	20101701
GO:0050431	Function	Transforming growth factor beta binding	IBA
GO:0050431	Function	Transforming growth factor beta binding	IDA	7852346, 11157754, 18243111, 18453574, 34568316
GO:0050431	Function	Transforming growth factor beta binding	IEA
GO:0050431	Function	Transforming growth factor beta binding	IPI	7852346, 11157754
GO:0050431	Function	Transforming growth factor beta binding	IPI	1326540, 1333888
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051138	Process	Positive regulation of NK T cell differentiation	IEA
GO:0051138	Process	Positive regulation of NK T cell differentiation	ISS
GO:0051216	Process	Cartilage development	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060021	Process	Roof of mouth development	IMP	20101701
GO:0060090	Function	Molecular adaptor activity	EXP	18243111
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	11157754, 18453574
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	24606633, 28131417
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060433	Process	Bronchus development	IEA
GO:0060434	Process	Bronchus morphogenesis	IEA
GO:0060439	Process	Trachea morphogenesis	IEA
GO:0060440	Process	Trachea formation	IEA
GO:0060443	Process	Mammary gland morphogenesis	IEA
GO:0060463	Process	Lung lobe morphogenesis	IEA
GO:0061520	Process	Langerhans cell differentiation	IEA
GO:0062009	Process	Secondary palate development	IEA
GO:0062009	Process	Secondary palate development	ISS
GO:0070021	Component	Transforming growth factor beta ligand-receptor complex	IPI	18243111, 20207738
GO:0070021	Component	Transforming growth factor beta ligand-receptor complex	ISS
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0070723	Process	Response to cholesterol	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0072091	Process	Regulation of stem cell proliferation	IEA
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905315	Process	Cell proliferation involved in endocardial cushion morphogenesis	ISS
GO:1905316	Process	Superior endocardial cushion morphogenesis	ISS
GO:1905317	Process	Inferior endocardial cushion morphogenesis	IEA
GO:1905317	Process	Inferior endocardial cushion morphogenesis	ISS
GO:1990086	Process	Lens fiber cell apoptotic process	IEA
GO:1990428	Process	MiRNA transport	IEA
GO:1990428	Process	MiRNA transport	ISS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IMP	20160708
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	17164348
GO:2000736	Process	Regulation of stem cell differentiation	IMP	21490602

MIM	HGNC	e!Ensembl
190182	11773	ENSG00000163513

P37173

Protein name

TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II)

Protein function

Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from th

PDB

1KTZ , 1M9Z , 1PLO , 2PJY , 3KFD , 4P7U , 4XJJ , 5E8V , 5E8Y , 5E91 , 5E92 , 5QIN , 5TX4 , 5TY4 , 7DV6 , 8G4K , 8YGZ , 9B9F , 9E9G , 9FDY , 9FK5 , 9FKP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08917	ecTbetaR2	49 → 159	Transforming growth factor beta receptor 2 ectodomain	Domain
PF07714	PK_Tyr_Ser-Thr	244 → 538	Protein tyrosine and serine/threonine kinase	Domain

Sequence

MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK

Sequence length

567

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (16)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Adenocarcinoma of the large intestine	Pathogenic	rs104893815	RCV006253510	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular phenotype	Pathogenic; Likely pathogenic	rs886038794, rs886038847, rs886038787, rs104893810, rs104893811, rs104893819, rs1559472349	RCV000244146 RCV000247764 RCV000243905 RCV005628227 RCV000252297 RCV005403719 RCV005405302 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Colorectal cancer, hereditary nonpolyposis, type 6	Pathogenic; Likely pathogenic	rs587776769, rs104893815, rs104893819, rs1553630171	RCV000013324 RCV000013336 RCV000763512 RCV000765721	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Connective tissue disorder	Pathogenic	rs863223852	RCV000680613	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ehlers-Danlos syndrome	Likely pathogenic	rs104893810	RCV002278083	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Likely pathogenic; Pathogenic	rs1575158079, rs2125439164, rs2125455181, rs2125455285, rs2125455193, rs1057524810, rs104893811, rs121918714, rs772490613, rs1699352567, rs2125437095, rs193922661, rs587782979, rs727503476, rs727503472 View all (54 more)	RCV002546347 RCV001378115 RCV001378116 RCV001378117 RCV001905849 View all (71 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Isolated thoracic aortic aneurysm	Likely pathogenic	rs528566980	RCV001374781	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Loeys-Dietz syndrome	Likely pathogenic; Pathogenic	rs587782979, rs1575158954, rs727503476, rs727503472, rs727504292, rs727504421, rs863223852, rs869025537, rs104893815, rs104893810, rs104893819, rs193922664, rs397516840	RCV000143955 RCV002251696 RCV000588481 RCV000152004 RCV000154307 View all (8 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz syndrome 1	Likely pathogenic; Pathogenic	rs886039551, rs1575165272	RCV000624602 RCV000856739	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Loeys-Dietz syndrome 2	Likely pathogenic; Pathogenic	rs1575158079, rs2125434732, rs104893810, rs104893811, rs104893816, rs2125436184, rs587782979, rs2125436754, rs1575158954, rs2125439099, rs727503476, rs727504292, rs727504421, rs863223852, rs863224935 View all (21 more)	RCV001329672 RCV001724739 RCV001730017 RCV001806344 RCV001806345 View all (35 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malignant tumor of esophagus	Likely pathogenic; Pathogenic	rs1575158079, rs2125451831, rs121918714, rs104893819, rs1553630171, rs1575166666	RCV002246310 RCV002246771 RCV000013326 RCV000763512 RCV000765721 RCV002249611 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marfan syndrome	Likely pathogenic; Pathogenic	rs876658120, rs727504421	RCV000217150 RCV000987137	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs104893810	RCV004668719	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Squamous cell carcinoma of the head and neck	Pathogenic	rs1553631693	RCV005898458	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TGFBR2-related disorder	Likely pathogenic; Pathogenic	rs886039551, rs104893810, rs2470568337	RCV003401218 RCV003904831 RCV004755001	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Wolff-Parkinson-White pattern	Likely pathogenic	rs1553631968	RCV000656212	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (54)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AORTIC ANEURYSM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, FAMILIAL THORACIC 3	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, THORACIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISSECTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ascending tubular aorta aneurysm	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS, HEREDITARY NONPOLYPOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital aneurysm of ascending aorta	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CONGENITAL CONTRACTURAL ARACHNODACTYLY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONSTITUTIONAL MISMATCH REPAIR DEFICIENCY SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic retinopathy	Conflicting classifications of pathogenicity; Uncertain risk allele; Uncertain significance; Likely benign; Benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DIRECT INGUINAL HERNIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION OF AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial colorectal cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LOEYS-DIETZ SYNDROME, TYPE 1A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lynch syndrome	Conflicting classifications of pathogenicity	ClinVar Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Malignant tumor of urinary bladder	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME TYPE 2	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MISMATCH REPAIR CANCER SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple congenital anomalies/dysmorphic syndrome	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED ABDOMINAL AORTIC ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED AORTIC ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED THORACIC AORTIC ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF THE ESOPHAGUS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thoracic aortic aneurysm	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thoracic aortic dissection	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACOABDOMINAL AORTIC ANEURYSM, RUPTURED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dilatation	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOLFF-PARKINSON-WHITE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (552)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abdominal Migraine	Abdominal Migraine	CTD_human_DG	16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Migraine	Confusional Migraine	CTD_human_DG	16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adams-Oliver syndrome 1	Adams-Oliver Syndrome	BEFREE	23554019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15976377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17566598, 18381416, 22399565, 27835699, 9664904, 9679977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12399125, 21911454, 22399565, 23625632, 25928368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	9598801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31579415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	9566701, 9679977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10559252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	16673206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	LHGDN	16673206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29315015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30666961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agnosia	Agnosia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alagille Syndrome	Alagille syndrome	Pubtator	22336710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Albinism Oculocutaneous	Oculocutaneous albinism	Pubtator	30219046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20701609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	23185447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33083483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	20648054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29259249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	10789724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	25313366	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	16928994, 35689619, 37864304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	CTD_human_DG	16027248, 16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	21270064, 27017342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	16380996, 19957108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21926469, 26279302, 30659170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	LHGDN	16283890		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	CTD_human_DG	16885183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic aneurysm	Pubtator	17330129, 23099432, 35689619, 40243722	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	BEFREE	19672284, 20358619		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	19672284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	19672284, 23099432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	19434696, 19672284, 21855067, 21978186, 22310065, 26352243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic aneurysm, familial thoracic 3	Aortic Aneurysm	GENOMICS_ENGLAND_DG	12975342, 15731757, 16928994, 17979970, 23161884, 26888179		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic aneurysm, familial thoracic 3	Aortic Aneurysm	UNIPROT_DG	15235604, 15731757, 16027248, 16251899, 19533785, 19883511, 20101701, 20358619, 21949523, 22113417		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic aneurysm, familial thoracic 3	Aortic Aneurysm	CLINVAR_DG	28344185		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic aneurysm, familial thoracic 3	Aortic Aneurysm	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	16027248, 17935258, 30101859		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracic	Aortic Aneurysm	CTD_human_DG	16027248		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracoabdominal	Aortic Aneurysm	CTD_human_DG	16027248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic disease	Pubtator	20354336, 27879313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	27879313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	16885183, 19336958, 19996017, 20648054, 21567932, 21815248, 27879313, 28847661, 30101859, 30158670, 31915033, 33083483, 33408307, 33494990, 35078481, 35689619, 40243722 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Dissection	Aortic dissection	Pubtator	36007983	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic valve disorder	Aortic Valve Disease	BEFREE	24093773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	24037531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnodactyly	Arachnodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	19959123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ARTERIAL TORTUOSITY SYNDROME	Arterial Tortuosity Syndrome	BEFREE	16928994, 26398550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Tortuosity Syndrome	Arterial tortuosity syndrome	Pubtator	27879313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ARTERIAL TORTUOSITY SYNDROME	Arterial Tortuosity Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	8601720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	28344185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20599261, 23884466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23884466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	30987013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16733295, 19302374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	20101701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23228659		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17339425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	17950544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	27935819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of central nervous system	Benign Neoplasm Of Nervous System	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of esophagus	Benign neoplasm of esophagus	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	18721526, 21524434, 23578328, 26708639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16849474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	12374683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22895549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	CTD_human_DG	20358619		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases Metabolic	Bone disease	Pubtator	22095581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19604240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	CTD_human_DG	16489006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	27935819		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	27935819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	10766860, 9648930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10938386, 11744689, 12825850, 17032151, 22158050, 22539603, 25007960, 25365407, 25833830, 26279296, 26621531, 27703260, 28443643, 28987542, 29101386 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11444526, 11590145, 11744689, 12421823, 19914962, 21527583, 22539603, 23022998, 23220853, 24036662, 24337772, 25365407, 25542272, 25579546, 26551005 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16827122, 26823785, 39525474	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30004628	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	21911454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10811940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	18591412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27456940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10934138, 11253131, 17047049, 19820113, 26114631, 27120811, 29699590, 33296708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	15599934	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10398102, 14654931, 20979647, 9207270, 9808525, 9935148		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	10789724		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16489684, 19426152, 20531292, 22684895, 23826206, 28472799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36374927, 7639583	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of esophagus	Esophageal Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22895549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11719467, 16163707, 17117417, 21911454, 22399565, 26356817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	11531253, 26091707, 27533245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24465802, 25791160, 28810144, 31912090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11531253, 30852945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11253131, 30232004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28102840	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	8763422, 9178800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27533245, 30713798, 9766642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	10789724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiac diverticulum	Cardiac Diverticulum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	26146998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	19996017, 21127203, 39744939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20956634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22259224, 31915033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36007983	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	29496669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 1	Cerebral Cavernous Malformation	BEFREE	25472749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	BEFREE	28557134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10598939		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28112728, 28195144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Migraine Syndrome	Migraine	CTD_human_DG	16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28112728, 28195144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19229971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26627606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32986368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38281914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	26432598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	22554650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19424605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	15731757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11535541, 16108056, 17985359, 18985362, 19293232, 23468914, 25687406, 27270652, 7665626, 9664904, 9679977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16108056, 17985359		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	16380996, 20979647, 23468914	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	7761852		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER, HEREDITARY NONPOLYPOSIS, TYPE 6	Colorectal Cancer	UNIPROT_DG	9590282		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COLORECTAL CANCER, HEREDITARY NONPOLYPOSIS, TYPE 6	Colorectal Cancer	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COLORECTAL CANCER, HEREDITARY NONPOLYPOSIS, TYPE 6	Colorectal Cancer	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10077641, 10565295, 11159190, 11212236, 15676142, 16012936, 17270239, 18546042, 20026115, 20197483, 20565851, 21362268, 21949851, 22912877, 23139211 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10077641, 10732761, 10789724, 11761441, 12057899, 12378627, 15599934, 19018265, 19503063, 20026115, 20565851, 21078976, 21949851, 22072622, 22278155 View all (22 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10763829, 19208363, 28376875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17270239, 19020727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26061281	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27008710	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	11687624, 11920458, 24415879, 26247575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital aneurysm of ascending aorta	Congenital Aneurysm Of Ascending Aorta	BEFREE	16027248, 16885183, 21324918		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	17345643, 17470566		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	BEFREE	18721526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital musculoskeletal anomalies	Congenital Musculoskeletal Anomalies	LHGDN	17470566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	15235604, 18377530, 20662850, 21270064, 28847661		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective Tissue Diseases	Connective tissue disease	Pubtator	30675029	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective Tissue Diseases	Connective Tissue Disease	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12736050, 20073064, 25011053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	21127203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19959123, 27234600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19959123, 27234600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19959123, 34565095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Dissection Spontaneous	Spontaneous coronary artery dissection	Pubtator	35092149, 36103205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19959123, 27234600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	15731757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	9207270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	9923802	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	16634896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18398939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29554973, 30629676, 31068441, 31571401, 9334355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	16634896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Descending aortic dissection	Descending aortic dissection	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Coordination Disorder	Developmental dyspraxia	BEFREE	30070022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	21567932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18505441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18505441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30461200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	LHGDN	12060054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17319955, 28954822	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	15496156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17319955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17319955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissecting aortic aneurysm	Dissecting Aortic Aneurysm	BEFREE	12821554, 16027248, 17935258, 30101859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	CTD_human_DG	16027248, 16885183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissection of aorta	Aortic dissection	BEFREE	19996017, 21524434		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissection of aorta	Aortic dissection	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
dowling-degos disease	Dowling-Degos Disease	BEFREE	28392965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	19344999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	24220024, 27344223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28043895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	25365407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	25365407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	15731757, 16928994, 21098638, 21593863, 24793577, 26724507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	20358619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyspnea, Paroxysmal	Dyspnea, Paroxysmal	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	23884466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	16928994, 20648054, 30070022		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10854545, 15993480, 22116456, 7585631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10947082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27533245, 30713798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10789724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	UNIPROT_DG	10789724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	10789724		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33448310, 34725559	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10789724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	24687999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	24687999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10508522, 18097622, 29039480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exotropia	Exotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30536105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial mitral valve prolapse	Mitral Valve Prolapse	BEFREE	24243761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25644172, 36007983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINGEN_DG	12821554, 12948523, 15235604, 15731757, 16027248, 16791849, 16885183, 18781618, 20628007, 21979435, 24355923, 24401272, 25555948, 26494233		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINVAR_DG	15235604, 15731757, 16027248, 16251899, 16799921, 16928994, 17652900, 17935258, 18084123, 18781618, 18827873, 19006214, 19159394, 19542084, 19996017 View all (18 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	GENOMICS_ENGLAND_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Fibrosis, Liver	Liver Fibrosis	BEFREE	21037076, 25108224, 30024280, 30562760, 30592264, 31641222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	14531804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	8971166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	23884466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	23884466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21785915, 22722999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	16634896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17684491, 29888103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25256166, 26670566, 30256570, 33025417, 35982888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17684491, 27527869, 29888103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18813789, 30256570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30256570, 31960827, 36153326, 36181980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	21567932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	9561480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	23940728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	27345036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	34916229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	7664267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	15731757, 25617554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35078481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemicrania migraine	Hemicrania Migraine	CTD_human_DG	16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemiplegia/hemiparesis	Hemiplegia/hemiparesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30940161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25365407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	BEFREE	11399952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	19886734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary non-polyposis colorectal cancer syndrome	Hereditary nonpolyposis colorectal cancer	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10419916, 10690536, 10772416, 11159190, 12374683, 15350299, 26247575, 30275229, 7488133, 7665626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CTD_human_DG	9590282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary nonpolyposis colorectal carcinoma	Hereditary nonpolyposis colorectal cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12215842, 15350299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	9590282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29315015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	29116087	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24687999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18097622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24687999, 25365407, 29196166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	28894026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	28894026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29699590	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11139485, 16429395, 18097622, 29196166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11713352, 38069069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26315535, 28131417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	11139485, 18097622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10096572, 31559420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31559420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inguinal Hernia, Indirect	Inguinal Hernia	CTD_human_DG	16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	15731757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	19542084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	27835699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	19208363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	15731757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	21978186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	18613964	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31559420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	21609163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	18199825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31754396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31685628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31754396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Larsen syndrome	Larsen Syndrome	BEFREE	17470566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	12920253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19700613, 30871768, 35639702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	19906824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	21917900, 24578538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	24578538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28052022		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	17566598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24846200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17566598, 20020490, 20531292, 26627606, 28352351, 28472799, 9815784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30592264, 38243118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	38146363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	39805388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30940161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Aortic Aneurysm Syndrome	Loeys-Dietz Syndrome	CTD_human_DG	15235604, 18084123, 19006214, 20358619, 22772368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Aortic Aneurysm Syndrome	Loeys-Dietz Syndrome	ORPHANET_DG	15731757, 16928994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Aortic Aneurysm Syndrome	Loeys-Dietz Syndrome	BEFREE	16596670, 16791849, 16799921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	GENOMICS_ENGLAND_DG	12975342, 16928994, 23161884, 26888179		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	CTD_human_DG	15235604, 18084123, 19006214, 20358619, 22772368		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	ORPHANET_DG	15731757, 16928994		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	CLINVAR_DG	15731757, 16283890, 16799921, 16835936, 16928994, 17330129, 17935258, 18084123, 18781618, 18852674, 21098638, 21267002, 22095581, 22113417, 22772377 View all (4 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz syndrome	Loeys-Dietz Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	BEFREE	16799921, 17061023, 17470566, 17652900, 17935258, 18377530, 18721526, 18852674, 19006214, 19159394, 19542084, 19772952, 19875893, 19883511, 20101701 View all (22 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome, Type 1a	Loeys-Dietz Syndrome	CTD_human_DG	15235604, 18084123, 19006214, 20358619, 22772368		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Loeys-Dietz Syndrome, Type 1a	Loeys-Dietz Syndrome	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT Syndrome	Long qt syndrome	Pubtator	30158670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17676583, 22015293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33430962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11074608		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15976377, 17653092, 22571197, 28662101, 33414372, 36902378	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	26356817	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17364494	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15599934, 22278155, 26823785	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24415879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26551005	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	14704634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	26247575, 30275229		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lynch Syndrome	Lynch Syndrome	CTD_human_DG	9590282		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lynch syndrome	Lynch Syndrome	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	CTD_human_DG	16489006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	27935819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10938386, 11744689, 12825850, 17032151, 22158050, 22539603, 25007960, 25365407, 25833830, 26279296, 26621531, 27703260, 28443643, 28987542, 29101386 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15993480, 22116456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	10789724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	12374683, 8971166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10565295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11074608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11719467, 16163707, 17117417, 21911454, 22028617, 22399565, 26356817, 9163705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23913824, 24846200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11406536, 27533245, 9766642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11507078, 12420225, 14978241, 23237571, 30366420, 31730895, 9850059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16887915, 18381416, 22290877, 22895549, 23951322, 24037531, 24141771, 29228234, 29352019, 29699590, 29782499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18381416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12353499, 17187359, 25315765, 27120811, 29247570, 29434905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22895549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10938386, 12399125, 12661003, 12692838, 15235604, 18339844, 18381416, 19223462, 20020490, 22452939, 23695722, 24606633, 25315765, 25374194, 25631750 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28112728, 28195144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10789724, 11535541, 12378532, 14988818, 16108056, 17985359, 18985362, 19293232, 20026115, 21949851, 25687406, 27270652, 7665626, 8840981, 9664904, 9679977, 9927040 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	7761852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11212236, 12825850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12825850, 14760070, 18043895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	15235604, 16027248, 16251899, 16596670, 16791849, 16799921, 16820601, 16835936, 16885183, 16981219, 17418587, 17935258, 17936924, 18377530, 18721526 View all (18 more)		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan Syndrome	CTD_human_DG	15235604		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan syndrome	Pubtator	15235604, 17330129, 17652900, 17935258, 18591412, 18781618, 19336958, 19996017, 20354336, 21567932, 21789464, 22259224, 22300218, 24220024, 27175573 View all (9 more)	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan Syndrome	LHGDN	15861007, 16835936, 18781618		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan syndrome	Pubtator	35052435	Inhibit	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan Syndrome	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome type 2	Marfan Syndrome	BEFREE	15235604, 16791849, 21098638, 21567932, 8946175		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome type 2	Marfan Syndrome	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan syndrome type 2	Marfan Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome, Type I	Marfan Syndrome	CTD_human_DG	15235604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome, Type I	Marfan Syndrome	BEFREE	18781618, 19159394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	14988818, 29986714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	7614683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21109473, 24920276, 25204799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	7614683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	19542084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29051557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29051557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	22904682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	21567932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	21567932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	CTD_human_DG	16885183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	BEFREE	24266335, 24852292		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	BEFREE	24852292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine without Aura	Migraine	Pubtator	22683712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	24243761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22259224, 9410894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21352603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	21127203, 29098351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	21127203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21093933, 31829262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	22431140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	22431140		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	8892669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10214859, 27716259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18570662, 31328403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22391627, 24606633, 28810605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24606633	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm of skeletal system	Neoplasm of skeletal system	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10096572, 10226558, 10470113, 10508522, 10565295, 10749119, 10894600, 11212236, 11251160, 11410498, 11535541, 11896591, 12692838, 12736050, 12825850 View all (74 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	27935819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	12787399		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29259249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32612149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	15496156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15073112, 17566598, 22399565, 25024357, 26356817, 28588663, 29239816, 30475986, 31113460, 31735321, 9163705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	34916229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31685628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16827122, 9632722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29514696, 31571401, 33834880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23133552, 37781043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	9766642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	25365407		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11477138, 15258697, 27533245		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27533245, 34884451, 35882447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11507078, 12420225, 14978241, 23237571, 30366420, 31730895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	12447993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26279302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15647279, 24465802, 25791160, 37322017, 37844011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Acute Necrotizing	Pancreatitis	Pubtator	9445116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	10400038	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	9851670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	18326816	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	14722581, 24146167, 27344223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	28894026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31565884, 9250163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35938797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	11843821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	11843821	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35427808, 39511342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	25365407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	25057952, 29375127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	27935819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	19604240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	18095113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16887915, 22290877, 22895549, 23951322, 24037531, 24141771, 29228234, 29352019, 29699590, 29782499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	20840324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	14654931, 29782499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15895377, 29699590	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16388503, 18724388		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16388503, 23951322	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18381416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	36672844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	16429395, 18097622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16227324	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16737987	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	GENOMICS_ENGLAND_DG	23161884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26216407, 30202956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	27935819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12736050, 20073064, 25011053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12736050, 12970754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12787399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19737884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20219075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23185447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	23884466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	27378305	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	18201469	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23185447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	18199825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	18097622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17560608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	17560608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	12794834, 15146427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	26333736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34126975	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30784922, 30797150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	12546068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	7777538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	17652900, 17979970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	33579826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	36672844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27558455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35886018	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35886018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34916229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28055980, 9163705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28055980, 32176034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylolisthesis	Spondylolisthesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	10206070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11410498, 25233932, 29934328, 30232004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17680270, 18202754, 18514338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17680270, 22314103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	ORPHANET_DG	17680270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11253131, 12920253, 17217620, 17676583, 22180460, 22641218, 29053175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21352603	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	22399565, 23625632, 31209059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27558455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the esophagus	Esophageal Carcinoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11600128, 16478646, 22180460		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Status Epilepticus	Status Epilepticus	BEFREE	27725160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Migrainosus	Status Migrainosus	CTD_human_DG	16885183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12353499, 17187359, 21666718, 25315765, 27120811, 29247570, 29434905, 9777952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11819821, 12353499, 24838641, 25222187, 27120811, 27304191, 33511732, 8090721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17187359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	34916229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12794834, 15146427, 30145936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	15146427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	36007983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27345036, 36606578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	9851670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	9888478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27345036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30004628	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35115500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	18941508, 32620917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	21362268, 31756952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18546042, 25687406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	10789724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	12975342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	CLINVAR_DG	28344185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31198976, 35241117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	32993576	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28112728, 28195144, 36105448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	21478096, 29267209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16928994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	16928994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16928994, 17330129, 9410894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	16594992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	19959123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	30158670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	20101701, 26022443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	20518838		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	20518838		★★★★★ ★☆☆☆☆ Found in Text Mining only

TGFBR2 (transforming growth factor beta receptor 2)