TGFBR1 (transforming growth factor beta receptor 1)

Gene

• Entrez ID: 7046
• Gene name: Transforming growth factor beta receptor 1
• Gene symbol: TGFBR1
• Synonyms (NCBI Gene): AAT5, ACVRLK4, ALK-5, ALK5, ESS1, LDS1, LDS1A, LDS2A, MSSE, SKR4, TBR-i, TBRI, TGFR-1, tbetaR-I
• Chromosome: 9
• Chromosome location: 9q22.33
• Summary: The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutation

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs11466445	GCGGCGGCGGCGGCG>-,GCG,GCGGCG,GCGGCGGCG,GCGGCGGCGGCG,GCGGCGGCGGCGGCGGCG,GCGGCGGCGGCGGCGGCGGCG,GCGGCGGCGGCGGCGGCGGCGGCG,GCGGCGGCGGCGGCGGCGGCGGCGGCG	Benign, conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign, benign-likely-benign	Intron variant, inframe deletion, inframe insertion, genic upstream transcript variant, coding sequence variant
rs111426349	C>A,G,T	Pathogenic, uncertain-significance	Coding sequence variant, synonymous variant, missense variant
rs111854391	C>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant, stop gained
rs113605875	G>A,C,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121918710	T>G	Pathogenic	Coding sequence variant, missense variant
rs121918711	A>G	Pathogenic	Coding sequence variant, missense variant
rs121918712	C>T	Pathogenic	Coding sequence variant, missense variant
rs121918713	G>T	Pathogenic	Coding sequence variant, missense variant, intron variant
rs145033378	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, 5 prime UTR variant, coding sequence variant
rs148176750	A>G	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, intron variant, coding sequence variant
rs190878719	G>A	Conflicting-interpretations-of-pathogenicity, benign-likely-benign, likely-benign	Coding sequence variant, synonymous variant, intron variant
rs387906696	A>G	Uncertain-significance, risk-factor	Missense variant, 5 prime UTR variant, coding sequence variant
rs387906697	C>T	Risk-factor, pathogenic	Stop gained, coding sequence variant
rs587776865	G>C	Uncertain-significance, risk-factor	Missense variant, 5 prime UTR variant, coding sequence variant
rs587776866	A>C	Risk-factor	Splice acceptor variant
rs727503470	G>A,T	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs730880223	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs759805984	T>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs760079636	G>A	Likely-pathogenic, pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs767589799	G>T	Likely-pathogenic	Coding sequence variant, missense variant
rs772339721	A>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs863223811	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223812	C>T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs863223814	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223815	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223816	A>C,G	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs863223817	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs863223819	A>G	Pathogenic	Coding sequence variant, missense variant
rs863223822	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs863223829	AAG>-	Pathogenic	Coding sequence variant, inframe deletion
rs863223832	C>A,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs869025535	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs878854714	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, coding sequence variant, genic upstream transcript variant, intron variant
rs886038919	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs886038954	->TG	Pathogenic	Coding sequence variant, frameshift variant
rs886039176	T>C,G	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1057524497	G>A,T	Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, stop gained, missense variant
rs1060502040	C>T	Pathogenic	Coding sequence variant, intron variant, stop gained
rs1060502042	G>A	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs1131691342	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1554700603	->TGG	Pathogenic	Coding sequence variant, inframe insertion
rs1554700672	G>T	Pathogenic	Coding sequence variant, stop gained
rs1554701881	A>C,G	Likely-pathogenic	Splice acceptor variant
rs1554701911	G>T	Pathogenic	Coding sequence variant, missense variant
rs1554701914	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1554702262	G>A	Pathogenic	Splice donor variant
rs1554702463	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1564161224	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1588585506	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1588585570	C>T	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000687	hsa-let-7c-5p	qRT-PCR, Luciferase reporter assay, Western blot	19841744
MIRT004650	hsa-miR-128-3p	Luciferase reporter assay, Western blot	20054641
MIRT003271	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT007379	hsa-miR-140-5p	Luciferase reporter assay	23401231
MIRT021634	hsa-miR-142-3p	Microarray	17612493
MIRT027382	hsa-miR-101-3p	Sequencing	20371350
MIRT027865	hsa-miR-98-5p	Microarray	19088304
MIRT032178	hsa-let-7d-5p	Sequencing	20371350
MIRT004650	hsa-miR-128-3p	CLASH	23622248
MIRT027382	hsa-miR-101-3p	Immunofluorescence, qRT-PCR	24817606
MIRT053633	hsa-let-7f-5p	Microarray	22942087
MIRT053635	hsa-miR-130a-3p	Microarray	22942087
MIRT053663	hsa-miR-181a-5p	Microarray	22942087
MIRT053663	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22714950
MIRT053663	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22714950
MIRT054832	hsa-let-7b-5p	GFP reporter assay, Western blot, ELISA	24978044
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23424236
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23424236
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23424236
MIRT437849	hsa-miR-376c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23424236
MIRT438737	hsa-miR-135b-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	24802670
MIRT438737	hsa-miR-135b-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	24802670
MIRT021634	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24558198
MIRT021634	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24558198
MIRT438737	hsa-miR-135b-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	24802670
MIRT438737	hsa-miR-135b-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	24802670
MIRT021634	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24558198
MIRT021634	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24558198
MIRT698515	hsa-miR-379-5p	HITS-CLIP	23313552
MIRT698514	hsa-miR-3529-5p	HITS-CLIP	23313552
MIRT698513	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT698512	hsa-miR-4643	HITS-CLIP	23313552
MIRT372394	hsa-miR-3927-3p	HITS-CLIP	23313552
MIRT372395	hsa-miR-6831-5p	HITS-CLIP	23313552
MIRT698511	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT698510	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT698509	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT698508	hsa-miR-204-3p	HITS-CLIP	23313552
MIRT698507	hsa-miR-4646-5p	HITS-CLIP	23313552
MIRT173515	hsa-miR-4668-5p	HITS-CLIP	23313552
MIRT698506	hsa-miR-3153	HITS-CLIP	23313552
MIRT698505	hsa-miR-6733-5p	HITS-CLIP	23313552
MIRT698504	hsa-miR-6739-5p	HITS-CLIP	23313552
MIRT698503	hsa-miR-466	HITS-CLIP	23313552
MIRT106691	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT106693	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT698502	hsa-miR-6888-3p	HITS-CLIP	23313552
MIRT496744	hsa-miR-8063	PAR-CLIP	22291592
MIRT173481	hsa-miR-1283	PAR-CLIP	22291592
MIRT496743	hsa-miR-4480	PAR-CLIP	22291592
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT021634	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT021634	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT732226	hsa-miR-490-3p	Luciferase reporter assay, Western blot	26714817
MIRT732226	hsa-miR-490-3p	Luciferase reporter assay, Western blot	26714817
MIRT173470	hsa-miR-202-5p	Luciferase reporter assay, Western blot	28373289
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blot	28095798
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blot	28095798
MIRT021634	hsa-miR-142-3p	Western blot	28146434
MIRT733703	hsa-miR-26a-5p	ELISA, Immunoprecipitaion (IP), Luciferase reporter assay, Western blotting	33857357
MIRT735954	hsa-miR-101-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, ELISA	32633566
MIRT736856	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, Flow cytometry	31591389
MIRT737292	hsa-miR-876-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32724369
MIRT027382	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	31831099
MIRT737575	hsa-let-7b-3p	Immunofluorescence, qRT-PCR	31614978
MIRT698515	hsa-miR-379-5p	HITS-CLIP	23313552
MIRT698514	hsa-miR-3529-5p	HITS-CLIP	23313552
MIRT698513	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT698512	hsa-miR-4643	HITS-CLIP	23313552
MIRT372394	hsa-miR-3927-3p	HITS-CLIP	23313552
MIRT372395	hsa-miR-6831-5p	HITS-CLIP	23313552
MIRT698511	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT698510	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT698509	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT698508	hsa-miR-204-3p	HITS-CLIP	23313552
MIRT698507	hsa-miR-4646-5p	HITS-CLIP	23313552
MIRT173515	hsa-miR-4668-5p	HITS-CLIP	23313552
MIRT698506	hsa-miR-3153	HITS-CLIP	23313552
MIRT698505	hsa-miR-6733-5p	HITS-CLIP	23313552
MIRT698504	hsa-miR-6739-5p	HITS-CLIP	23313552
MIRT698503	hsa-miR-466	HITS-CLIP	23313552
MIRT106691	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT106693	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT698502	hsa-miR-6888-3p	HITS-CLIP	23313552
MIRT496744	hsa-miR-8063	PAR-CLIP	22291592
MIRT173481	hsa-miR-1283	PAR-CLIP	22291592
MIRT496743	hsa-miR-4480	PAR-CLIP	22291592
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT323791	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT323788	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT004650	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT323787	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466411	hsa-miR-3156-5p	PAR-CLIP	23592263
MIRT173532	hsa-miR-8083	PAR-CLIP	23592263
MIRT466410	hsa-miR-6887-3p	PAR-CLIP	23592263
MIRT466409	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT466408	hsa-miR-6826-3p	PAR-CLIP	23592263
MIRT323789	hsa-miR-27b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38825706
MIRT755812	mmu-let-7a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35386460
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT1421227	hsa-miR-1200	CLIP-seq
MIRT1421228	hsa-miR-1208	CLIP-seq
MIRT1421229	hsa-miR-1224-3p	CLIP-seq
MIRT1421230	hsa-miR-1236	CLIP-seq
MIRT1421231	hsa-miR-1245	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421233	hsa-miR-1260	CLIP-seq
MIRT1421234	hsa-miR-1260b	CLIP-seq
MIRT1421235	hsa-miR-1280	CLIP-seq
MIRT1421236	hsa-miR-1305	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT1421238	hsa-miR-141	CLIP-seq
MIRT1421239	hsa-miR-150	CLIP-seq
MIRT1421240	hsa-miR-151-3p	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1421245	hsa-miR-188-3p	CLIP-seq
MIRT1421246	hsa-miR-193a-3p	CLIP-seq
MIRT1421247	hsa-miR-193b	CLIP-seq
MIRT1421248	hsa-miR-200a	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT1421250	hsa-miR-221	CLIP-seq
MIRT1421251	hsa-miR-222	CLIP-seq
MIRT1421252	hsa-miR-3064-3p	CLIP-seq
MIRT1421253	hsa-miR-3074-3p	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421255	hsa-miR-3128	CLIP-seq
MIRT1421256	hsa-miR-3140-3p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421258	hsa-miR-3146	CLIP-seq
MIRT1421259	hsa-miR-3148	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT1421261	hsa-miR-3157-5p	CLIP-seq
MIRT1421262	hsa-miR-3160-5p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421264	hsa-miR-3174	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT1421267	hsa-miR-34b	CLIP-seq
MIRT1421268	hsa-miR-3545-5p	CLIP-seq
MIRT1421269	hsa-miR-3607-3p	CLIP-seq
MIRT1421270	hsa-miR-3614-5p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421272	hsa-miR-3622a-3p	CLIP-seq
MIRT1421273	hsa-miR-3622b-3p	CLIP-seq
MIRT1421274	hsa-miR-3646	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT1421276	hsa-miR-3667-3p	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421278	hsa-miR-3682-3p	CLIP-seq
MIRT1421279	hsa-miR-3685	CLIP-seq
MIRT1421280	hsa-miR-3686	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT1421283	hsa-miR-380	CLIP-seq
MIRT1421284	hsa-miR-384	CLIP-seq
MIRT1421285	hsa-miR-3921	CLIP-seq
MIRT1421286	hsa-miR-3925-3p	CLIP-seq
MIRT1421287	hsa-miR-3973	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT1421289	hsa-miR-4251	CLIP-seq
MIRT1421290	hsa-miR-4252	CLIP-seq
MIRT1421291	hsa-miR-4261	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT1421293	hsa-miR-4280	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT1421295	hsa-miR-4297	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT1421297	hsa-miR-4326	CLIP-seq
MIRT1421298	hsa-miR-4329	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT1421300	hsa-miR-4433	CLIP-seq
MIRT1421301	hsa-miR-4434	CLIP-seq
MIRT1421302	hsa-miR-4452	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT1421304	hsa-miR-4460	CLIP-seq
MIRT1421305	hsa-miR-4464	CLIP-seq
MIRT1421306	hsa-miR-4496	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421308	hsa-miR-4506	CLIP-seq
MIRT1421309	hsa-miR-4516	CLIP-seq
MIRT1421310	hsa-miR-452	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT1421313	hsa-miR-4637	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT1421316	hsa-miR-4653-5p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT1421318	hsa-miR-4676-3p	CLIP-seq
MIRT1421319	hsa-miR-4680-3p	CLIP-seq
MIRT1421320	hsa-miR-4684-3p	CLIP-seq
MIRT1421321	hsa-miR-4691-3p	CLIP-seq
MIRT1421322	hsa-miR-4694-3p	CLIP-seq
MIRT1421323	hsa-miR-4698	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT1421325	hsa-miR-4701-5p	CLIP-seq
MIRT1421326	hsa-miR-4711-3p	CLIP-seq
MIRT1421327	hsa-miR-4720-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421329	hsa-miR-4748	CLIP-seq
MIRT1421330	hsa-miR-4753-3p	CLIP-seq
MIRT1421331	hsa-miR-4756-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421333	hsa-miR-4768-5p	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT1421335	hsa-miR-4786-5p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1421337	hsa-miR-4795-5p	CLIP-seq
MIRT1421338	hsa-miR-4799-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT1421341	hsa-miR-510	CLIP-seq
MIRT1421342	hsa-miR-512-5p	CLIP-seq
MIRT1421343	hsa-miR-520a-5p	CLIP-seq
MIRT1421344	hsa-miR-520g	CLIP-seq
MIRT1421345	hsa-miR-520h	CLIP-seq
MIRT1421346	hsa-miR-521	CLIP-seq
MIRT1421347	hsa-miR-522	CLIP-seq
MIRT1421348	hsa-miR-525-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421351	hsa-miR-548a-5p	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421353	hsa-miR-548ab	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT1421355	hsa-miR-548ak	CLIP-seq
MIRT1421356	hsa-miR-548b-5p	CLIP-seq
MIRT1421357	hsa-miR-548c-3p	CLIP-seq
MIRT1421358	hsa-miR-548c-5p	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT1421360	hsa-miR-548d-5p	CLIP-seq
MIRT1421361	hsa-miR-548h	CLIP-seq
MIRT1421362	hsa-miR-548i	CLIP-seq
MIRT1421363	hsa-miR-548j	CLIP-seq
MIRT1421364	hsa-miR-548k	CLIP-seq
MIRT1421365	hsa-miR-548l	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT1421367	hsa-miR-548v	CLIP-seq
MIRT1421368	hsa-miR-548w	CLIP-seq
MIRT1421369	hsa-miR-548y	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT1421371	hsa-miR-559	CLIP-seq
MIRT1421372	hsa-miR-577	CLIP-seq
MIRT1421373	hsa-miR-579	CLIP-seq
MIRT1421374	hsa-miR-580	CLIP-seq
MIRT1421375	hsa-miR-587	CLIP-seq
MIRT1421376	hsa-miR-588	CLIP-seq
MIRT1421377	hsa-miR-640	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT1421379	hsa-miR-665	CLIP-seq
MIRT1421380	hsa-miR-766	CLIP-seq
MIRT1421381	hsa-miR-885-5p	CLIP-seq
MIRT1421382	hsa-miR-921	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT1421384	hsa-miR-101	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421385	hsa-miR-130a	CLIP-seq
MIRT1421386	hsa-miR-130b	CLIP-seq
MIRT1421387	hsa-miR-1343	CLIP-seq
MIRT1421388	hsa-miR-144	CLIP-seq
MIRT1421389	hsa-miR-153	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT1421391	hsa-miR-301a	CLIP-seq
MIRT1421392	hsa-miR-301b	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421393	hsa-miR-3121-5p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421394	hsa-miR-3164	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421395	hsa-miR-3194-3p	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT1421396	hsa-miR-3660	CLIP-seq
MIRT1421397	hsa-miR-3666	CLIP-seq
MIRT1421398	hsa-miR-3671	CLIP-seq
MIRT1421279	hsa-miR-3685	CLIP-seq
MIRT1421399	hsa-miR-371-5p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421400	hsa-miR-376a	CLIP-seq
MIRT1421401	hsa-miR-376b	CLIP-seq
MIRT1421284	hsa-miR-384	CLIP-seq
MIRT1421402	hsa-miR-3977	CLIP-seq
MIRT1421403	hsa-miR-4254	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT1421404	hsa-miR-4295	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT1421405	hsa-miR-4422	CLIP-seq
MIRT1421301	hsa-miR-4434	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT1421406	hsa-miR-448	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421308	hsa-miR-4506	CLIP-seq
MIRT1421309	hsa-miR-4516	CLIP-seq
MIRT1421407	hsa-miR-4526	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT1421408	hsa-miR-454	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT1421409	hsa-miR-4671-3p	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421410	hsa-miR-4760-3p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT1421411	hsa-miR-489	CLIP-seq
MIRT1421412	hsa-miR-520d-5p	CLIP-seq
MIRT1421413	hsa-miR-524-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421414	hsa-miR-548a-3p	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421415	hsa-miR-548e	CLIP-seq
MIRT1421416	hsa-miR-548f	CLIP-seq
MIRT1421417	hsa-miR-561	CLIP-seq
MIRT1421418	hsa-miR-578	CLIP-seq
MIRT1421373	hsa-miR-579	CLIP-seq
MIRT1421419	hsa-miR-584	CLIP-seq
MIRT1421420	hsa-miR-607	CLIP-seq
MIRT1421421	hsa-miR-619	CLIP-seq
MIRT1421422	hsa-miR-664	CLIP-seq
MIRT1421423	hsa-miR-711	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT1554589	hsa-miR-1294	CLIP-seq
MIRT1421387	hsa-miR-1343	CLIP-seq
MIRT1421239	hsa-miR-150	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1554590	hsa-miR-192	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT1554591	hsa-miR-215	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421400	hsa-miR-376a	CLIP-seq
MIRT1421401	hsa-miR-376b	CLIP-seq
MIRT1554592	hsa-miR-3927	CLIP-seq
MIRT1421290	hsa-miR-4252	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT1554593	hsa-miR-4264	CLIP-seq
MIRT1554594	hsa-miR-4276	CLIP-seq
MIRT1421405	hsa-miR-4422	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1554595	hsa-miR-4650-3p	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1554597	hsa-miR-4773	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1554598	hsa-miR-4797-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421365	hsa-miR-548l	CLIP-seq
MIRT1554599	hsa-miR-548n	CLIP-seq
MIRT1554600	hsa-miR-548t	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT1554601	hsa-miR-642a	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT2126384	hsa-miR-1183	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421236	hsa-miR-1305	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT2126386	hsa-miR-2115	CLIP-seq
MIRT2126387	hsa-miR-300	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2126388	hsa-miR-331-5p	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT2126389	hsa-miR-338-3p	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421283	hsa-miR-380	CLIP-seq
MIRT2126390	hsa-miR-381	CLIP-seq
MIRT2126391	hsa-miR-3910	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT1554593	hsa-miR-4264	CLIP-seq
MIRT2126393	hsa-miR-4272	CLIP-seq
MIRT2126394	hsa-miR-4282	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT2126395	hsa-miR-4325	CLIP-seq
MIRT2126396	hsa-miR-4436b-5p	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT2126397	hsa-miR-4493	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT2126398	hsa-miR-4530	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT2126399	hsa-miR-4641	CLIP-seq
MIRT2126400	hsa-miR-4659a-3p	CLIP-seq
MIRT2126401	hsa-miR-4659b-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT2126402	hsa-miR-4712-5p	CLIP-seq
MIRT2126403	hsa-miR-4727-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT2126404	hsa-miR-4769-3p	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT1421337	hsa-miR-4795-5p	CLIP-seq
MIRT1554598	hsa-miR-4797-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2126405	hsa-miR-507	CLIP-seq
MIRT2126406	hsa-miR-5095	CLIP-seq
MIRT2126407	hsa-miR-516a-3p	CLIP-seq
MIRT1421344	hsa-miR-520g	CLIP-seq
MIRT1421345	hsa-miR-520h	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT2126408	hsa-miR-544	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT1421365	hsa-miR-548l	CLIP-seq
MIRT1554599	hsa-miR-548n	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT2126409	hsa-miR-557	CLIP-seq
MIRT1421374	hsa-miR-580	CLIP-seq
MIRT1421375	hsa-miR-587	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT2126411	hsa-miR-770-5p	CLIP-seq
MIRT1421381	hsa-miR-885-5p	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT2348396	hsa-miR-10a	CLIP-seq
MIRT2348397	hsa-miR-10b	CLIP-seq
MIRT2126384	hsa-miR-1183	CLIP-seq
MIRT2348398	hsa-miR-1206	CLIP-seq
MIRT2348399	hsa-miR-124	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT2348400	hsa-miR-1265	CLIP-seq
MIRT2348401	hsa-miR-1298	CLIP-seq
MIRT1421385	hsa-miR-130a	CLIP-seq
MIRT1421386	hsa-miR-130b	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT2348402	hsa-miR-1324	CLIP-seq
MIRT2348403	hsa-miR-133a	CLIP-seq
MIRT2348404	hsa-miR-133b	CLIP-seq
MIRT1421387	hsa-miR-1343	CLIP-seq
MIRT2348405	hsa-miR-142-5p	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT2348406	hsa-miR-1976	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT2348407	hsa-miR-2110	CLIP-seq
MIRT2126386	hsa-miR-2115	CLIP-seq
MIRT2348408	hsa-miR-2392	CLIP-seq
MIRT1421391	hsa-miR-301a	CLIP-seq
MIRT1421392	hsa-miR-301b	CLIP-seq
MIRT2348409	hsa-miR-3115	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT2348410	hsa-miR-3120-3p	CLIP-seq
MIRT1421393	hsa-miR-3121-5p	CLIP-seq
MIRT1421255	hsa-miR-3128	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT2348411	hsa-miR-3145-3p	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT2348412	hsa-miR-3157-3p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2348413	hsa-miR-331-3p	CLIP-seq
MIRT2348414	hsa-miR-338-5p	CLIP-seq
MIRT2348415	hsa-miR-33a	CLIP-seq
MIRT2348416	hsa-miR-33b	CLIP-seq
MIRT2348417	hsa-miR-340	CLIP-seq
MIRT1421267	hsa-miR-34b	CLIP-seq
MIRT2348418	hsa-miR-34c-3p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421396	hsa-miR-3660	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT2348419	hsa-miR-3663-3p	CLIP-seq
MIRT1421397	hsa-miR-3666	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT2348420	hsa-miR-3675-5p	CLIP-seq
MIRT2348421	hsa-miR-369-3p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT2348422	hsa-miR-374a	CLIP-seq
MIRT2348423	hsa-miR-374b	CLIP-seq
MIRT1421400	hsa-miR-376a	CLIP-seq
MIRT1421401	hsa-miR-376b	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT2348424	hsa-miR-3922-5p	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT1421291	hsa-miR-4261	CLIP-seq
MIRT1554593	hsa-miR-4264	CLIP-seq
MIRT2348425	hsa-miR-4271	CLIP-seq
MIRT2348426	hsa-miR-4277	CLIP-seq
MIRT2348427	hsa-miR-4279	CLIP-seq
MIRT2348428	hsa-miR-4281	CLIP-seq
MIRT2348429	hsa-miR-4289	CLIP-seq
MIRT1421294	hsa-miR-4291	CLIP-seq
MIRT1421404	hsa-miR-4295	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT2126395	hsa-miR-4325	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT1421405	hsa-miR-4422	CLIP-seq
MIRT2348430	hsa-miR-4438	CLIP-seq
MIRT1421304	hsa-miR-4460	CLIP-seq
MIRT2348431	hsa-miR-4471	CLIP-seq
MIRT1421310	hsa-miR-452	CLIP-seq
MIRT1421407	hsa-miR-4526	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT1421408	hsa-miR-454	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT2126400	hsa-miR-4659a-3p	CLIP-seq
MIRT2126401	hsa-miR-4659b-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT1421409	hsa-miR-4671-3p	CLIP-seq
MIRT1421318	hsa-miR-4676-3p	CLIP-seq
MIRT2348433	hsa-miR-4687-3p	CLIP-seq
MIRT2348434	hsa-miR-4695-3p	CLIP-seq
MIRT2348435	hsa-miR-4717-3p	CLIP-seq
MIRT2348436	hsa-miR-4719	CLIP-seq
MIRT1421327	hsa-miR-4720-5p	CLIP-seq
MIRT2348437	hsa-miR-4725-3p	CLIP-seq
MIRT2348438	hsa-miR-4725-5p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421410	hsa-miR-4760-3p	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT2348439	hsa-miR-4794	CLIP-seq
MIRT1421337	hsa-miR-4795-5p	CLIP-seq
MIRT1554598	hsa-miR-4797-3p	CLIP-seq
MIRT1421338	hsa-miR-4799-3p	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2348440	hsa-miR-483-3p	CLIP-seq
MIRT1421411	hsa-miR-489	CLIP-seq
MIRT2348441	hsa-miR-504	CLIP-seq
MIRT2348442	hsa-miR-506	CLIP-seq
MIRT2126405	hsa-miR-507	CLIP-seq
MIRT2126406	hsa-miR-5095	CLIP-seq
MIRT2348443	hsa-miR-513b	CLIP-seq
MIRT2126407	hsa-miR-516a-3p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT2348444	hsa-miR-542-5p	CLIP-seq
MIRT1421350	hsa-miR-545	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT2348449	hsa-miR-556-3p	CLIP-seq
MIRT2126409	hsa-miR-557	CLIP-seq
MIRT1421417	hsa-miR-561	CLIP-seq
MIRT1421373	hsa-miR-579	CLIP-seq
MIRT2348450	hsa-miR-586	CLIP-seq
MIRT1421375	hsa-miR-587	CLIP-seq
MIRT2348451	hsa-miR-634	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT1421423	hsa-miR-711	CLIP-seq
MIRT2348452	hsa-miR-802	CLIP-seq
MIRT2348453	hsa-miR-874	CLIP-seq
MIRT1421381	hsa-miR-885-5p	CLIP-seq
MIRT1421382	hsa-miR-921	CLIP-seq
MIRT2348454	hsa-miR-938	CLIP-seq
MIRT2395715	hsa-miR-24	CLIP-seq
MIRT2395716	hsa-miR-3155	CLIP-seq
MIRT2395717	hsa-miR-3155b	CLIP-seq
MIRT2348430	hsa-miR-4438	CLIP-seq
MIRT1421315	hsa-miR-4652-3p	CLIP-seq
MIRT2395718	hsa-miR-484	CLIP-seq
MIRT2126406	hsa-miR-5095	CLIP-seq
MIRT2395719	hsa-miR-922	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT1421241	hsa-miR-181a	CLIP-seq
MIRT1421242	hsa-miR-181b	CLIP-seq
MIRT1421243	hsa-miR-181c	CLIP-seq
MIRT1421244	hsa-miR-181d	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT1421262	hsa-miR-3160-5p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT1421266	hsa-miR-337-3p	CLIP-seq
MIRT1421277	hsa-miR-3673	CLIP-seq
MIRT1421279	hsa-miR-3685	CLIP-seq
MIRT1421284	hsa-miR-384	CLIP-seq
MIRT2433827	hsa-miR-3936	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT1421292	hsa-miR-4262	CLIP-seq
MIRT2126394	hsa-miR-4282	CLIP-seq
MIRT2126397	hsa-miR-4493	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT1421314	hsa-miR-4639-3p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT1421324	hsa-miR-4699-3p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT1421334	hsa-miR-4774-5p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT2433828	hsa-miR-4799-5p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2433829	hsa-miR-500a	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT2433830	hsa-miR-659	CLIP-seq
MIRT2433831	hsa-miR-668	CLIP-seq
MIRT2433832	hsa-miR-9	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT2348396	hsa-miR-10a	CLIP-seq
MIRT2348397	hsa-miR-10b	CLIP-seq
MIRT2348398	hsa-miR-1206	CLIP-seq
MIRT2641158	hsa-miR-1252	CLIP-seq
MIRT2348400	hsa-miR-1265	CLIP-seq
MIRT2641159	hsa-miR-1270	CLIP-seq
MIRT2641160	hsa-miR-1275	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT2348402	hsa-miR-1324	CLIP-seq
MIRT2348405	hsa-miR-142-5p	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT2641161	hsa-miR-183	CLIP-seq
MIRT1421245	hsa-miR-188-3p	CLIP-seq
MIRT2641162	hsa-miR-1909	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT2641163	hsa-miR-2053	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT2641164	hsa-miR-2278	CLIP-seq
MIRT2348408	hsa-miR-2392	CLIP-seq
MIRT1421252	hsa-miR-3064-3p	CLIP-seq
MIRT2641165	hsa-miR-3123	CLIP-seq
MIRT2641166	hsa-miR-3136-5p	CLIP-seq
MIRT2348411	hsa-miR-3145-3p	CLIP-seq
MIRT2641167	hsa-miR-3151	CLIP-seq
MIRT2641168	hsa-miR-3156-3p	CLIP-seq
MIRT2641169	hsa-miR-3160-3p	CLIP-seq
MIRT2641170	hsa-miR-3187-3p	CLIP-seq
MIRT2641171	hsa-miR-3192	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2641172	hsa-miR-3200-5p	CLIP-seq
MIRT2641173	hsa-miR-3202	CLIP-seq
MIRT2641174	hsa-miR-324-5p	CLIP-seq
MIRT2641175	hsa-miR-330-3p	CLIP-seq
MIRT2641176	hsa-miR-337-5p	CLIP-seq
MIRT2126389	hsa-miR-338-3p	CLIP-seq
MIRT2348417	hsa-miR-340	CLIP-seq
MIRT2641177	hsa-miR-3612	CLIP-seq
MIRT2641178	hsa-miR-3614-3p	CLIP-seq
MIRT1421274	hsa-miR-3646	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT1421399	hsa-miR-371-5p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT2641179	hsa-miR-382	CLIP-seq
MIRT2348424	hsa-miR-3922-5p	CLIP-seq
MIRT1421286	hsa-miR-3925-3p	CLIP-seq
MIRT2641180	hsa-miR-3925-5p	CLIP-seq
MIRT2433827	hsa-miR-3936	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT2641181	hsa-miR-4270	CLIP-seq
MIRT2348426	hsa-miR-4277	CLIP-seq
MIRT2641182	hsa-miR-4287	CLIP-seq
MIRT2641183	hsa-miR-4301	CLIP-seq
MIRT2641184	hsa-miR-4303	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT2641185	hsa-miR-4314	CLIP-seq
MIRT2641186	hsa-miR-432	CLIP-seq
MIRT2641187	hsa-miR-4320	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT2641188	hsa-miR-4330	CLIP-seq
MIRT2641189	hsa-miR-4420	CLIP-seq
MIRT2641190	hsa-miR-4439	CLIP-seq
MIRT2641191	hsa-miR-4441	CLIP-seq
MIRT2641192	hsa-miR-4447	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT2348431	hsa-miR-4471	CLIP-seq
MIRT2641193	hsa-miR-4472	CLIP-seq
MIRT2641194	hsa-miR-4487	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT2641195	hsa-miR-4513	CLIP-seq
MIRT2641196	hsa-miR-4520a-5p	CLIP-seq
MIRT2641197	hsa-miR-4520b-5p	CLIP-seq
MIRT2641198	hsa-miR-4525	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT2641199	hsa-miR-4529-5p	CLIP-seq
MIRT2126398	hsa-miR-4530	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT2641200	hsa-miR-4533	CLIP-seq
MIRT2126399	hsa-miR-4641	CLIP-seq
MIRT2641201	hsa-miR-4645-3p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT2641202	hsa-miR-4665-5p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT2641203	hsa-miR-4670-3p	CLIP-seq
MIRT2641204	hsa-miR-4685-3p	CLIP-seq
MIRT2641205	hsa-miR-4686	CLIP-seq
MIRT2641206	hsa-miR-4688	CLIP-seq
MIRT1421322	hsa-miR-4694-3p	CLIP-seq
MIRT1421323	hsa-miR-4698	CLIP-seq
MIRT2641207	hsa-miR-4704-3p	CLIP-seq
MIRT2126402	hsa-miR-4712-5p	CLIP-seq
MIRT2348436	hsa-miR-4719	CLIP-seq
MIRT2641208	hsa-miR-4722-5p	CLIP-seq
MIRT2641209	hsa-miR-4723-5p	CLIP-seq
MIRT2348438	hsa-miR-4725-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT2641210	hsa-miR-4733-5p	CLIP-seq
MIRT2641211	hsa-miR-4762-5p	CLIP-seq
MIRT2641212	hsa-miR-4768-3p	CLIP-seq
MIRT2126404	hsa-miR-4769-3p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT2641213	hsa-miR-4792	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT2348440	hsa-miR-483-3p	CLIP-seq
MIRT2641214	hsa-miR-491-5p	CLIP-seq
MIRT2433829	hsa-miR-500a	CLIP-seq
MIRT2348441	hsa-miR-504	CLIP-seq
MIRT2348443	hsa-miR-513b	CLIP-seq
MIRT2641215	hsa-miR-515-5p	CLIP-seq
MIRT1421343	hsa-miR-520a-5p	CLIP-seq
MIRT1421348	hsa-miR-525-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT2348444	hsa-miR-542-5p	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2641216	hsa-miR-548ag	CLIP-seq
MIRT2641217	hsa-miR-548ai	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT2641218	hsa-miR-548m	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT2348449	hsa-miR-556-3p	CLIP-seq
MIRT2641219	hsa-miR-558	CLIP-seq
MIRT2641220	hsa-miR-593	CLIP-seq
MIRT2641221	hsa-miR-620	CLIP-seq
MIRT2641222	hsa-miR-625	CLIP-seq
MIRT2348451	hsa-miR-634	CLIP-seq
MIRT2641223	hsa-miR-650	CLIP-seq
MIRT2641224	hsa-miR-657	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT1421380	hsa-miR-766	CLIP-seq
MIRT2641225	hsa-miR-767-3p	CLIP-seq
MIRT2126411	hsa-miR-770-5p	CLIP-seq
MIRT2641226	hsa-miR-890	CLIP-seq
MIRT2641227	hsa-miR-892a	CLIP-seq
MIRT2641228	hsa-miR-944	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq
MIRT1421219	hsa-let-7a	CLIP-seq
MIRT1421220	hsa-let-7b	CLIP-seq
MIRT1421221	hsa-let-7c	CLIP-seq
MIRT1421222	hsa-let-7d	CLIP-seq
MIRT1421223	hsa-let-7e	CLIP-seq
MIRT1421224	hsa-let-7f	CLIP-seq
MIRT1421225	hsa-let-7g	CLIP-seq
MIRT1421226	hsa-let-7i	CLIP-seq
MIRT2126384	hsa-miR-1183	CLIP-seq
MIRT2348398	hsa-miR-1206	CLIP-seq
MIRT2693008	hsa-miR-1207-3p	CLIP-seq
MIRT2693009	hsa-miR-1256	CLIP-seq
MIRT1421232	hsa-miR-1258	CLIP-seq
MIRT2693010	hsa-miR-1264	CLIP-seq
MIRT2348400	hsa-miR-1265	CLIP-seq
MIRT2641159	hsa-miR-1270	CLIP-seq
MIRT2641160	hsa-miR-1275	CLIP-seq
MIRT1421237	hsa-miR-1323	CLIP-seq
MIRT2348402	hsa-miR-1324	CLIP-seq
MIRT2348405	hsa-miR-142-5p	CLIP-seq
MIRT2126385	hsa-miR-145	CLIP-seq
MIRT2641161	hsa-miR-183	CLIP-seq
MIRT2693011	hsa-miR-186	CLIP-seq
MIRT1421245	hsa-miR-188-3p	CLIP-seq
MIRT2641162	hsa-miR-1909	CLIP-seq
MIRT1421249	hsa-miR-202	CLIP-seq
MIRT2641163	hsa-miR-2053	CLIP-seq
MIRT1421390	hsa-miR-2054	CLIP-seq
MIRT2126386	hsa-miR-2115	CLIP-seq
MIRT2641164	hsa-miR-2278	CLIP-seq
MIRT2348408	hsa-miR-2392	CLIP-seq
MIRT1421252	hsa-miR-3064-3p	CLIP-seq
MIRT1421254	hsa-miR-3117-3p	CLIP-seq
MIRT2641165	hsa-miR-3123	CLIP-seq
MIRT2693012	hsa-miR-3133	CLIP-seq
MIRT2693013	hsa-miR-3135b	CLIP-seq
MIRT1421257	hsa-miR-3143	CLIP-seq
MIRT2348411	hsa-miR-3145-3p	CLIP-seq
MIRT1421259	hsa-miR-3148	CLIP-seq
MIRT2641167	hsa-miR-3151	CLIP-seq
MIRT1421260	hsa-miR-3152-3p	CLIP-seq
MIRT2641168	hsa-miR-3156-3p	CLIP-seq
MIRT2641169	hsa-miR-3160-3p	CLIP-seq
MIRT1421263	hsa-miR-3169	CLIP-seq
MIRT2693014	hsa-miR-3170	CLIP-seq
MIRT2641170	hsa-miR-3187-3p	CLIP-seq
MIRT2641171	hsa-miR-3192	CLIP-seq
MIRT1421265	hsa-miR-3200-3p	CLIP-seq
MIRT2641172	hsa-miR-3200-5p	CLIP-seq
MIRT2641173	hsa-miR-3202	CLIP-seq
MIRT2641174	hsa-miR-324-5p	CLIP-seq
MIRT2641175	hsa-miR-330-3p	CLIP-seq
MIRT2641176	hsa-miR-337-5p	CLIP-seq
MIRT2126389	hsa-miR-338-3p	CLIP-seq
MIRT2348414	hsa-miR-338-5p	CLIP-seq
MIRT2348417	hsa-miR-340	CLIP-seq
MIRT1421269	hsa-miR-3607-3p	CLIP-seq
MIRT2641177	hsa-miR-3612	CLIP-seq
MIRT2641178	hsa-miR-3614-3p	CLIP-seq
MIRT1421270	hsa-miR-3614-5p	CLIP-seq
MIRT1421271	hsa-miR-3617	CLIP-seq
MIRT1421274	hsa-miR-3646	CLIP-seq
MIRT1421275	hsa-miR-3662	CLIP-seq
MIRT1421280	hsa-miR-3686	CLIP-seq
MIRT1421399	hsa-miR-371-5p	CLIP-seq
MIRT1421281	hsa-miR-371b-5p	CLIP-seq
MIRT1421282	hsa-miR-376c	CLIP-seq
MIRT1421283	hsa-miR-380	CLIP-seq
MIRT2641179	hsa-miR-382	CLIP-seq
MIRT1421286	hsa-miR-3925-3p	CLIP-seq
MIRT2641180	hsa-miR-3925-5p	CLIP-seq
MIRT2433827	hsa-miR-3936	CLIP-seq
MIRT1421288	hsa-miR-3976	CLIP-seq
MIRT2126392	hsa-miR-4255	CLIP-seq
MIRT2693015	hsa-miR-4260	CLIP-seq
MIRT2641181	hsa-miR-4270	CLIP-seq
MIRT2348426	hsa-miR-4277	CLIP-seq
MIRT2641182	hsa-miR-4287	CLIP-seq
MIRT2641183	hsa-miR-4301	CLIP-seq
MIRT2641184	hsa-miR-4303	CLIP-seq
MIRT1421296	hsa-miR-4307	CLIP-seq
MIRT2641185	hsa-miR-4314	CLIP-seq
MIRT2641186	hsa-miR-432	CLIP-seq
MIRT2641187	hsa-miR-4320	CLIP-seq
MIRT2126395	hsa-miR-4325	CLIP-seq
MIRT1421299	hsa-miR-433	CLIP-seq
MIRT2641188	hsa-miR-4330	CLIP-seq
MIRT2641189	hsa-miR-4420	CLIP-seq
MIRT1421301	hsa-miR-4434	CLIP-seq
MIRT2641191	hsa-miR-4441	CLIP-seq
MIRT2641192	hsa-miR-4447	CLIP-seq
MIRT1421303	hsa-miR-4458	CLIP-seq
MIRT2641193	hsa-miR-4472	CLIP-seq
MIRT2693016	hsa-miR-4477a	CLIP-seq
MIRT2641194	hsa-miR-4487	CLIP-seq
MIRT1421307	hsa-miR-4500	CLIP-seq
MIRT1421309	hsa-miR-4516	CLIP-seq
MIRT2641196	hsa-miR-4520a-5p	CLIP-seq
MIRT2641197	hsa-miR-4520b-5p	CLIP-seq
MIRT2641198	hsa-miR-4525	CLIP-seq
MIRT1421311	hsa-miR-4528	CLIP-seq
MIRT2641199	hsa-miR-4529-5p	CLIP-seq
MIRT2126398	hsa-miR-4530	CLIP-seq
MIRT1421312	hsa-miR-4531	CLIP-seq
MIRT2641200	hsa-miR-4533	CLIP-seq
MIRT2126399	hsa-miR-4641	CLIP-seq
MIRT2641201	hsa-miR-4645-3p	CLIP-seq
MIRT2126400	hsa-miR-4659a-3p	CLIP-seq
MIRT2126401	hsa-miR-4659b-3p	CLIP-seq
MIRT1421317	hsa-miR-4662a-5p	CLIP-seq
MIRT2641202	hsa-miR-4665-5p	CLIP-seq
MIRT1554596	hsa-miR-4666-3p	CLIP-seq
MIRT2348432	hsa-miR-4666-5p	CLIP-seq
MIRT2641203	hsa-miR-4670-3p	CLIP-seq
MIRT2641204	hsa-miR-4685-3p	CLIP-seq
MIRT2641205	hsa-miR-4686	CLIP-seq
MIRT2641206	hsa-miR-4688	CLIP-seq
MIRT1421322	hsa-miR-4694-3p	CLIP-seq
MIRT1421323	hsa-miR-4698	CLIP-seq
MIRT2641207	hsa-miR-4704-3p	CLIP-seq
MIRT2126402	hsa-miR-4712-5p	CLIP-seq
MIRT2348436	hsa-miR-4719	CLIP-seq
MIRT1421327	hsa-miR-4720-5p	CLIP-seq
MIRT2641208	hsa-miR-4722-5p	CLIP-seq
MIRT2641209	hsa-miR-4723-5p	CLIP-seq
MIRT1421328	hsa-miR-4731-3p	CLIP-seq
MIRT2641210	hsa-miR-4733-5p	CLIP-seq
MIRT2693017	hsa-miR-4744	CLIP-seq
MIRT1421332	hsa-miR-4759	CLIP-seq
MIRT2641211	hsa-miR-4762-5p	CLIP-seq
MIRT2641212	hsa-miR-4768-3p	CLIP-seq
MIRT2126404	hsa-miR-4769-3p	CLIP-seq
MIRT1421336	hsa-miR-4789-5p	CLIP-seq
MIRT2641213	hsa-miR-4792	CLIP-seq
MIRT1421338	hsa-miR-4799-3p	CLIP-seq
MIRT1421339	hsa-miR-4801	CLIP-seq
MIRT1421340	hsa-miR-4803	CLIP-seq
MIRT2348440	hsa-miR-483-3p	CLIP-seq
MIRT2641214	hsa-miR-491-5p	CLIP-seq
MIRT2433829	hsa-miR-500a	CLIP-seq
MIRT2126405	hsa-miR-507	CLIP-seq
MIRT2348443	hsa-miR-513b	CLIP-seq
MIRT2641215	hsa-miR-515-5p	CLIP-seq
MIRT2126407	hsa-miR-516a-3p	CLIP-seq
MIRT1421343	hsa-miR-520a-5p	CLIP-seq
MIRT1421347	hsa-miR-522	CLIP-seq
MIRT1421348	hsa-miR-525-5p	CLIP-seq
MIRT1421349	hsa-miR-526b	CLIP-seq
MIRT1421352	hsa-miR-548aa	CLIP-seq
MIRT1421354	hsa-miR-548ac	CLIP-seq
MIRT2348445	hsa-miR-548ae	CLIP-seq
MIRT2641216	hsa-miR-548ag	CLIP-seq
MIRT2641217	hsa-miR-548ai	CLIP-seq
MIRT2348446	hsa-miR-548aj	CLIP-seq
MIRT2348447	hsa-miR-548am	CLIP-seq
MIRT1421359	hsa-miR-548d-3p	CLIP-seq
MIRT1421364	hsa-miR-548k	CLIP-seq
MIRT2641218	hsa-miR-548m	CLIP-seq
MIRT1421366	hsa-miR-548o	CLIP-seq
MIRT2348448	hsa-miR-548x	CLIP-seq
MIRT1421370	hsa-miR-548z	CLIP-seq
MIRT2348449	hsa-miR-556-3p	CLIP-seq
MIRT2126409	hsa-miR-557	CLIP-seq
MIRT2641219	hsa-miR-558	CLIP-seq
MIRT2693018	hsa-miR-570	CLIP-seq
MIRT2641220	hsa-miR-593	CLIP-seq
MIRT2641221	hsa-miR-620	CLIP-seq
MIRT2641222	hsa-miR-625	CLIP-seq
MIRT2348451	hsa-miR-634	CLIP-seq
MIRT1421378	hsa-miR-641	CLIP-seq
MIRT2641223	hsa-miR-650	CLIP-seq
MIRT2641224	hsa-miR-657	CLIP-seq
MIRT2126410	hsa-miR-676	CLIP-seq
MIRT1421380	hsa-miR-766	CLIP-seq
MIRT2641225	hsa-miR-767-3p	CLIP-seq
MIRT2126411	hsa-miR-770-5p	CLIP-seq
MIRT2641226	hsa-miR-890	CLIP-seq
MIRT2641227	hsa-miR-892a	CLIP-seq
MIRT2641228	hsa-miR-944	CLIP-seq
MIRT1421383	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SMAD7	Repression	15221015
WWP1	Repression	15221015

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	ISS
GO:0001525	Process	Angiogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001824	Process	Blastocyst development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	15761148
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	ISS
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	IEA
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	ISS
GO:0003223	Process	Ventricular compact myocardium morphogenesis	IEA
GO:0003223	Process	Ventricular compact myocardium morphogenesis	ISS
GO:0003342	Process	Proepicardium development	ISS
GO:0004672	Function	Protein kinase activity	IDA	19736306
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12065756, 18625725
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IDA	12015308, 19736306
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IEA
GO:0005024	Function	Transforming growth factor beta receptor activity	IC	1326540
GO:0005024	Function	Transforming growth factor beta receptor activity	IDA	12015308, 12065756, 14633705
GO:0005024	Function	Transforming growth factor beta receptor activity	IEA
GO:0005024	Function	Transforming growth factor beta receptor activity	IMP	1333888
GO:0005024	Function	Transforming growth factor beta receptor activity	IMP	18625725
GO:0005025	Function	Transforming growth factor beta receptor activity, type I	IBA
GO:0005025	Function	Transforming growth factor beta receptor activity, type I	IDA	8752209
GO:0005025	Function	Transforming growth factor beta receptor activity, type I	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IDA	11157754
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IPI	1333888
GO:0005515	Function	Protein binding	IPI	8622651, 10025408, 11278302, 11279102, 11583628, 12015308, 14517293, 14580334, 15702480, 15761148, 17099224, 18243111, 18625725, 18758450, 18974388, 19732720, 20856203, 21791611, 22344298, 23723426, 23868260, 24263861, 24658140, 25893292, 26583432
GO:0005524	Function	ATP binding	IDA	12065756
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	26583432
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IDA	26583432
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17878231, 21791611, 25893292
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	18243111, 20207738
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	IDA	15761148
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005929	Component	Cilium	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	14517293
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	15702480
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IDA	14633705
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IC	1326540
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	18548003
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	1333888, 9311995, 9389648, 11157754, 12065756
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	22714950
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	1333888, 24978044, 27693460, 28251559
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007399	Process	Nervous system development	IBA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	14633705
GO:0008354	Process	Germ cell migration	IEA
GO:0008354	Process	Germ cell migration	ISS
GO:0008584	Process	Male gonad development	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	ISS
GO:0009986	Component	Cell surface	IDA	25893292
GO:0009986	Component	Cell surface	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	27162619
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016361	Function	Activin receptor activity, type I	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15761148
GO:0019838	Function	Growth factor binding	IPI	14517293
GO:0030154	Process	Cell differentiation	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030199	Process	Collagen fibril organization	ISS
GO:0030307	Process	Positive regulation of cell growth	IDA	18625725
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	19736306
GO:0030336	Process	Negative regulation of cell migration	IMP	23424236
GO:0031396	Process	Regulation of protein ubiquitination	IDA	18758450
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12151385
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	ISS
GO:0032924	Process	Activin receptor signaling pathway	IBA
GO:0032924	Process	Activin receptor signaling pathway	ISS
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0036446	Process	Myofibroblast differentiation	IMP	28251559
GO:0042060	Process	Wound healing	TAS	9759503
GO:0042118	Process	Endothelial cell activation	ISS
GO:0043062	Process	Extracellular structure organization	TAS	9759503
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043235	Component	Receptor complex	IDA	8774881, 14517293
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045121	Component	Membrane raft	IDA	25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9311995, 9389648
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0046332	Function	SMAD binding	IBA
GO:0046332	Function	SMAD binding	IDA	12065756, 18625725
GO:0046332	Function	SMAD binding	IEA
GO:0046332	Function	SMAD binding	IPI	8980228, 9311995
GO:0046847	Process	Filopodium assembly	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048179	Component	Activin receptor complex	IBA
GO:0048185	Function	Activin binding	IBA
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	ISS
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048705	Process	Skeletal system morphogenesis	ISS
GO:0048762	Process	Mesenchymal cell differentiation	ISS
GO:0048762	Process	Mesenchymal cell differentiation	TAS	9759503
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0048870	Process	Cell motility	IMP	18625725
GO:0050431	Function	Transforming growth factor beta binding	IDA	11157754
GO:0050431	Function	Transforming growth factor beta binding	IDA	14633705
GO:0050431	Function	Transforming growth factor beta binding	IEA
GO:0050431	Function	Transforming growth factor beta binding	IMP	1333888
GO:0050431	Function	Transforming growth factor beta binding	IPI	1326540
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0051726	Process	Regulation of cell cycle	TAS	9759503
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18625725
GO:0060017	Process	Parathyroid gland development	IEA
GO:0060017	Process	Parathyroid gland development	ISS
GO:0060021	Process	Roof of mouth development	IEA
GO:0060021	Process	Roof of mouth development	ISS
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	IEA
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	ISS
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	ISS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	9311995, 9389648, 11157754, 12015308, 18625725, 19736306
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IGI	22714950
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	27693460
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	IEA
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	ISS
GO:0060982	Process	Coronary artery morphogenesis	IEA
GO:0060982	Process	Coronary artery morphogenesis	ISS
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0070021	Component	Transforming growth factor beta ligand-receptor complex	IPI	18243111, 20207738
GO:0070021	Component	Transforming growth factor beta ligand-receptor complex	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0070411	Function	I-SMAD binding	IPI	11278251
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0070723	Process	Response to cholesterol	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	19494318
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0101023	Process	Vascular endothelial cell proliferation	IBA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IMP	28251559
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IGI	22714950
GO:1902554	Component	Serine/threonine protein kinase complex	IEA
GO:1904018	Process	Positive regulation of vasculature development	IMP	27693460
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905075	Process	Positive regulation of tight junction disassembly	IEA
GO:1905075	Process	Positive regulation of tight junction disassembly	ISS
GO:1905223	Process	Epicardium morphogenesis	IEA
GO:1905223	Process	Epicardium morphogenesis	ISS
GO:2000026	Process	Regulation of multicellular organismal development	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	18758450
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	18625725

Other IDs

• MIM: 190181
• HGNC: 11772
• e!Ensembl: ENSG00000106799

Protein

• UniProt ID: P36897
• Protein name: TGF-beta receptor type-1 (TGFR-1) (EC 2.7.11.30) (Activin A receptor type II-like protein kinase of 53kD) (Activin receptor-like kinase 5) (ALK-5) (ALK5) (Serine/threonine-protein kinase receptor R4) (SKR4) (TGF-beta type I receptor) (Transforming growth
• Protein function: Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from t
• PDB: 1B6C, 1IAS, 1PY5, 1RW8, 1VJY, 2L5S, 2PJY, 2WOT, 2WOU, 2X7O, 3FAA, 3GXL, 3HMM, 3KCF, 3KFD, 3TZM, 4X0M, 4X2F, 4X2G, 4X2J, 4X2K, 4X2N, 5E8S, 5E8T, 5E8U, 5E8W, 5E8X, 5E8Z, 5E90, 5FRI, 5QIK, 5QIL, 5QIM, 5QTZ, 5QU0, 5USQ, 6B8Y, 6MAC, 8YHF, 8YHL, 9B9F, 9F6X, 9FK5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01064	Activin_recp	34 → 110	Activin types I and II receptor domain	Domain
  PF08515	TGF_beta_GS	176 → 203	Transforming growth factor beta type I GS-motif	Family
  PF00069	Pkinase	205 → 492	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Found in all tissues examined, most abundant in placenta and least abundant in brain and heart. Expressed in a variety of cancer cell lines (PubMed:25893292). {ECO:0000269|PubMed:25893292}.
• Sequence:

  MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
  TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
  LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
  IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
  SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
  GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
  ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
  HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
  ARLTALRIKKTLSQLSQQEGIKM

• Sequence length: 503

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cardiovascular phenotype	Pathogenic; Likely pathogenic	rs113605875, rs111854391	RCV005403720 RCV000617152	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ehlers-Danlos syndrome	Likely pathogenic	rs863223811	RCV005625436	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial aortopathy	Likely pathogenic; Pathogenic	rs760079636, rs1060502046	RCV003235118 RCV001174650	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Likely pathogenic; Pathogenic	rs1827496704, rs1827126921, rs2118780524, rs2118804176, rs2118807458, rs2118803591, rs2118827924, rs2118841181, rs2118563240, rs2118707001, rs2118630690, rs2118840018, rs2118805827, rs730880223, rs2490192138, rs2490270668, rs1588585386, rs863223829, rs760079636, rs863223818, rs2118717103, rs2490145569, rs2490222983, rs2490236999, rs886038783, rs886038919, rs886038954, rs111854391, rs113605875, rs111426349, rs2490237898, rs2490141047, rs2490932279, rs2118711701, rs2490270618, rs2490107569, rs2490251246, rs1588585372, rs2490250508, rs144775920, rs2118805136, rs387906697, rs1060502042, rs1060502045, rs1060502046, rs1057524497, rs1554700672, rs1554701881, rs1554702262, rs1554698926, rs1554700603, rs1554702463, rs863223832, rs886039176, rs1827902114, rs1827647395, rs1827743139	RCV001322257 RCV003529479 RCV001379085 RCV001380154 RCV002540399 RCV002034646 RCV002542416 RCV002027689 RCV001985305 RCV001977635 RCV001993206 RCV001993470 RCV002304883 RCV002516367 RCV002394203 RCV002389083 RCV002746247 RCV001380058 RCV001187849 RCV001170914 RCV002975956 RCV003019221 RCV003042890 RCV003150768 RCV002310832 RCV001042584 RCV002310869 RCV000244262 RCV000211857 RCV000211856 RCV003528871 RCV003529113 RCV003529350 RCV003529731 RCV003643539 RCV003643813 RCV003644045 RCV003644398 RCV003644382 RCV003643483 RCV003818769 RCV003837750 RCV000474057 RCV000471274 RCV000464356 RCV000473430 RCV000538139 RCV000551498 RCV000614164 RCV000605493 RCV002315262 RCV002315260 RCV000660318 RCV000698286 RCV000766264 RCV001065118 RCV001227976 RCV002436985	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz syndrome	Pathogenic; Likely pathogenic	rs730880223, rs863223829, rs760079636, rs863223818, rs886038919, rs111854391, rs113605875, rs111426349, rs1588598651, rs1554701911	RCV000157517 RCV000825630 RCV000208245 RCV003993884 RCV000582499 RCV000030540 RCV000211857 RCV000211856 RCV003533864 RCV000584165	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz syndrome 1	Likely pathogenic; Pathogenic	rs1827496704, rs1827647083, rs2118780524, rs727503470, rs2118827924, rs2118858700, rs863223819, rs760079636, rs121918710, rs121918711, rs121918712, rs113605875, rs111854391, rs111426349, rs2118711701, rs2118712174, rs1554701914, rs1588585506, rs1827646767	RCV005050332 RCV001336713 RCV004594277 RCV001775443 RCV001806343 RCV002471487 RCV003147394 RCV002255135 RCV000119102 RCV000013346 RCV000013347 RCV000013348 RCV000013350 RCV000013351 RCV000013352 RCV005871247 RCV004017184 RCV000578271 RCV000623721 RCV000984475 RCV001280800	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Marfan syndrome	Likely pathogenic; Pathogenic	rs886038919, rs111854391	RCV002288945 RCV000845292	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple self-healing squamous epithelioma	Likely pathogenic; Pathogenic	rs1827496704, rs2118805586, rs2490104710, rs760079636, rs1827497991, rs111854391, rs111426349, rs387906697	RCV005050332 RCV001788938 RCV006249823 RCV005049472 RCV003333386 RCV003224094 RCV000763611 RCV000022805	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TGFBR1-related disorder	Pathogenic	rs113605875	RCV004730845	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic aneurysm, familial thoracic 6	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AORTIC DISSECTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CONTRACTURAL ARACHNODACTYLY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective tissue disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOSYNOSTOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniosynostosis syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disproportionate tall stature	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION OF AORTA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EHLERS-DANLOS SYNDROME CLASSIC TYPE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ehlers-Danlos syndrome, classic type	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Isolated thoracic aortic aneurysm	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE DERMATOMYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LOEYS-DIETZ SYNDROME, TYPE 1A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME TYPE 2	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thoracic aortic aneurysm	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WET MACULAR DEGENERATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adams-Oliver syndrome 1	Adams-Oliver Syndrome	BEFREE	23554019		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10416594, 31585122, 9850059		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20500843, 30959852		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19509225		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26586478		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASDB_DG	23455636		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASCAT_DG	23455636		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25867331, 28343170		★☆☆☆☆ Found in Text Mining only
Albinism Oculocutaneous	Oculocutaneous albinism	Pubtator	30219046	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28622298, 28781950		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	28324846		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	16928994, 37864304	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	21270064		★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	CTD_human_DG	22772368		★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22699812, 27248167		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	18781618, 40243722	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	19672284, 26027897	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	19672284, 26017485	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	18550062, 19434696, 19672284, 21855067, 21978186		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	27879313		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic disease	Pubtator	27879313, 32062130, 36599937	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	20648054, 21815248, 28847661, 31475485, 31915033, 35078481, 40243722	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Insufficiency	Aortic Valve Insufficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arachnodactyly	Arachnodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arachnodactyly	Arachnodactyly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
ARTERIAL TORTUOSITY SYNDROME	Arterial Tortuosity Syndrome	BEFREE	16928994, 26398550, 27879313		★☆☆☆☆ Found in Text Mining only
ARTERIAL TORTUOSITY SYNDROME	Arterial Tortuosity Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	33789563	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17317656		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17317656	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17594488, 20628268	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23884466		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23884466	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	30987013	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28639003, 31539152		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	31539152	Associate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15041079		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	8688329, 8895761		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18925687, 22935165		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	18925687	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	18721526, 28659821		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	37341068	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12947057, 19004027		★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	27234654	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	17848956		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10416594, 15833881, 16204663, 16428477, 17072348, 17848193, 17848956, 19390964, 21056993, 21461994, 21829601, 26165686, 26462028, 26583432, 26616150, 31257133		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17848193, 17848956, 18625725, 20332227, 21527583, 21829601, 22260435, 23022998, 23349840, 24658161, 26165686, 26703884, 28059167, 30987013, 33626035, 34093853, 35381768, 35484112	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11408925, 15382067, 9269901, 9809982		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	8688329	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	27533245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26648552, 28230858, 28594404, 29515105, 30943320, 32324847, 33684566, 36901700, 37044053, 39256453, 7639583	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12947057, 19004027		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17607123		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26091707, 27533245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25791160, 26588899	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27166254, 31339433	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21819702	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11601325		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26647384, 29751820		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	25918253	Associate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	30659312		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	31169351	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12812985		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31915033	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	28294324		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29432795		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15797633, 31435875		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15797633		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15797633, 31435875		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19229971		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15041079		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	19586667		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	15731757	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17890272, 19509225, 20705955		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17890272		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19538729	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12947057, 15860866, 16204663, 17507611, 17575241, 17613544, 18703712, 18778720, 19401691, 19509225, 19538729, 19930569, 19998449, 20368424, 20500843, 20705955, 21224855, 21811255, 21858550, 22292045, 24981199, 27234654, 29467907, 29971498, 30979739		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18703712		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16204663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17575241, 18703712, 18778720, 19036501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17890272, 18703712, 18778720, 19401691, 19509225, 19538729, 20500843, 20705955, 21068203, 21811255, 22278155, 22292045, 24981199, 26714817, 27234654, 27776350, 29986714, 36499586, 36791912, 37044020, 37443102	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18703712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19930569	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	18283546		★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	18721526		★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	17487218, 18377530, 21270064, 25116393, 28847661		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	30675029	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27166254, 28969055, 29662646, 31339433		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Artery Dissection Spontaneous	Spontaneous coronary artery dissection	Pubtator	33866193, 35092149	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	26703884		★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17594488, 19494318, 24034904, 28939526, 30078186, 30431382		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	29498756	Associate	★☆☆☆☆ Found in Text Mining only
Descending aortic dissection	Descending aortic dissection	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34930438	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21478266		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	LHGDN	12060054		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17319955	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17319955		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17319955		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31797450		★☆☆☆☆ Found in Text Mining only
Dissection Ascending Aorta	Dissection of aorta	Pubtator	34346740	Associate	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	CTD_human_DG	22772368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissection of aorta	Aortic dissection	BEFREE	27879313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissection of aorta	Aortic dissection	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	19344999	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyspnea, Paroxysmal	Dyspnea, Paroxysmal	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	23884466	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24333532		★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	16928994, 20648054		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EHLERS-DANLOS SYNDROME, CLASSIC TYPE, 1	Classical-Like Ehlers-Danlos Syndrome	CLINVAR_DG	30675029		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	29061957		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	30655341		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27171242, 28657664		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27171242, 36791912	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27171242	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	22223660		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28277133, 32635855	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28345488		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26647384, 29751820		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11910473		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11910473		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Exotropia	Exotropia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial mitral valve prolapse	Mitral Valve Prolapse	BEFREE	24243761		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25644172, 36007983	Associate	★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINVAR_DG	15731757, 16596670, 16791849, 16928994, 18455604, 18781618, 19542084, 21267002, 21358634, 22113417, 22414221, 23884466, 24793577, 25110237, 25521989, 25944730, 27611364, 30675029		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINGEN_DG	16791849, 18781618, 19542084, 22414221, 24355923, 26188975, 27146836, 27739498		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Fanconi Syndrome	Fanconi syndrome	Pubtator	34110636	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15723089, 24263861, 25502482, 30562760, 31171625		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	28560358		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	23884466	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21785915, 22722999		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	19098325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	18711401, 31008529		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25165192	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18711401, 31008529		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33494271, 37439825	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	28815607	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28815607		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	29788434		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28815787		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	17890272	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25273091	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	15731757	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32443848, 35078481	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32528555	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12947057		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	29061957	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	25502482, 29061957	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	15385056	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19930569	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	17848956		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	9722951		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	40325597	Associate	★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	24333532		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18097622, 19116361		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35406794	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	28894026		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	28894026	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22705563, 26090865, 31169351, 31339433, 32528555	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28628913		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31734320		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11713352	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30776489		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	15731757	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	19542084		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	15731757	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	21978186		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	29514696		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	21917900		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	40184725	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24855276		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31651066		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10219856, 15775675, 25820415, 29515105, 30115383, 30335615, 30836988, 30943320, 30963691		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	28560358		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Loeys-Dietz Aortic Aneurysm Syndrome	Loeys-Dietz Syndrome	ORPHANET_DG	15731757, 16928994		★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Aortic Aneurysm Syndrome	Loeys-Dietz Syndrome	BEFREE	16596670, 16791849, 16799921		★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Aortic Aneurysm Syndrome	Loeys-Dietz Syndrome	CTD_human_DG	20358619, 22772368		★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	CLINGEN_DG	15731757, 16928994, 19542084, 19883511, 24355923, 8242743		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	ORPHANET_DG	15731757, 16928994		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz syndrome	Loeys-Dietz Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	CLINVAR_DG	16791849, 16799921, 16928994, 18455604, 18703712, 18781618, 19542084, 21267002, 21358634, 22113417, 25644172, 26848186, 26877057, 27879313		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	BEFREE	16799921, 17061023, 18377530, 18852674, 19159394, 19542084, 19883511, 20101701, 20358619, 20648054, 20813212, 20956634, 21538815, 22095581, 23554019, 23884466, 24333532, 24344637, 24792298, 25116393, 28847661, 29350460, 29392890, 29706644, 30219046, 30513140, 31326520, 31475485, 31569402		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	GENOMICS_ENGLAND_DG	16799921, 16928994, 26888179		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	CTD_human_DG	20358619, 22772368		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Loeys-Dietz Syndrome, Type 1a	Loeys-Dietz Syndrome	UNIPROT_DG	15731757, 16596670, 16791849, 16928994, 19883511, 22113417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Loeys-Dietz Syndrome, Type 1a	Loeys-Dietz Syndrome	GENOMICS_ENGLAND_DG	15731757, 16799921, 16928994, 18070134, 24896178, 26888179		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Loeys-Dietz Syndrome, Type 1a	Loeys-Dietz Syndrome	CTD_human_DG	20358619, 22772368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Loeys-Dietz Syndrome, Type 1a	Loeys-Dietz Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	BEFREE	20089076		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17607123, 18421475		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24816813, 33231090	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17364494, 19020994	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22278155	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10515889		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32335702	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	14704634		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23455636, 33618707	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28815787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10416594, 15833881, 16204663, 16428477, 17072348, 17848193, 17848956, 19390964, 19930569, 21056993, 21461994, 21829601, 26165686, 26462028, 26583432, 26616150, 31257133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27171242, 28657664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11910473		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29808285		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17607123, 30971692		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31651066		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11406536		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27035876, 8760600		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15385056, 15505640, 24903149, 25982816, 30973040, 9633523		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	21358634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10602482, 22911926, 28522256, 31182928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12947057, 16428477, 19004027		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12812985, 12947057, 15231662, 15270668, 16204663, 17607123, 17890272, 18316594, 18925687, 19390964, 19509225, 19882361, 20429896, 21358634, 21461994, 22584670, 22905183, 24933703, 26074400, 26165686, 26583432, 27166254, 28522256, 29064324, 29132261, 29193723, 29662646, 30384428, 31481511, 9809982		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15797633, 31435875		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17890272, 19509225, 20705955		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12145287, 15155736, 16428477, 17848956		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	16799921, 16835936, 16981219, 17487218, 17936924, 18377530, 18781618, 19772952, 20538085, 21358634, 21789464, 24344637, 27112580, 28847661, 29350460, 29768367, 31098894		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan Syndrome	LHGDN	16835936, 18781618		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan syndrome	Pubtator	17652900, 18781618, 20354336, 22300218, 28847661, 40243722	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome	Marfan Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfan Syndrome, Type I	Marfan Syndrome	BEFREE	18781618, 19159394		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17565341, 24127404		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25204799, 32327630	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17565341	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37730606	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	19542084		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36901697	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29051557		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	24243761		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26433312	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29295981		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	29295981	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple self-healing epithelioma of Ferguson-Smith	Multiple Self-Healing Epithelioma	CLINGEN_DG	21358634, 22096025, 27558455		★☆☆☆☆ Found in Text Mining only
Multiple self-healing squamous epithelioma	Multiple Self-Healing Epithelioma	BEFREE	21358634, 24747516, 29706644, 30513140, 9439661, 9722951		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple self-healing squamous epithelioma	Multiple Self-Healing Epithelioma	ORPHANET_DG	21358634		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple self-healing squamous epithelioma	Multiple Self-Healing Epithelioma	CTD_human_DG	21358634		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple self-healing squamous epithelioma	Multiple Self-Healing Epithelioma	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24855276, 31481511		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	28405618		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22136666	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30053527		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	31169351	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29367682	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29017171		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29017171	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	17890272		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10515889, 11329144, 12947057, 15231662, 15385056, 15505640, 16204663, 17072348, 17297450, 17507611, 17575241, 17848956, 17890272, 19401691, 19509225, 19538729, 19998449, 20429896, 21225232, 22037217, 22859719, 23731466, 24747516, 25173755, 25622187, 25820415, 25976290, 26315674, 27100181, 27166254, 27267807, 27756784, 28575350, 29330296, 29531222, 29788434, 29855543, 29955905, 30557355, 30587556, 30971692, 30979739, 8636304, 8688329, 8760600, 8895761		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25153496, 27756784		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29017171		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12781426, 19690145, 21225232, 22699812, 29371929, 30387848, 30557355		★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25273091	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29514696	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23666869		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31592234		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31592234		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20354825, 20429896, 30710564		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20429896, 30710564	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	34630324	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26983758, 28064471, 34884451	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27035876, 8760600		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17297450, 22699812		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17230504, 8760600		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25791160, 26586478, 27035876	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33062039	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Acute Necrotizing	Pancreatitis	Pubtator	9445116	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	10400038	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29274137		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	30887626		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	28894026		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	28159509		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	31496148		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29409020, 30865275		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35427808	Associate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	28405618		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15385056, 15505640, 24903149, 25982816, 30973040, 9633523		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22705563, 25622187, 26152726, 26583432, 27166254, 29257105, 30138363, 30973040	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31734320		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	GENOMICS_ENGLAND_DG	16799921		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30448291		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37724521	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15382067, 28969055		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23486519, 24088962		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29034312		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17594488		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	23884466, 33596578	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	18201469	Stimulate	★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	31444797		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	14722617, 15146427, 16575856, 16947635, 17317656		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	17317656, 26357964	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	26333736	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	17072348		★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	18781618		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	16170343, 8499949, 9439661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	21358634		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	35886018	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	LHGDN	15955593		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17848956		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18202754		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29235674		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22314103		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31831099, 38287071, 39177040	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27558455		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16478646, 22037217, 22859719, 23421960, 23640975, 25871396, 28865486, 29193723, 29506555		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10602482, 22688186, 22911926, 28522256, 31182928		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1312080, 23188426, 25173755, 26811494, 28522256	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18174246		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	25173755		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	14722617, 15146427, 16575856, 16947635, 17317656		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	16947635		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15382067		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	29788434		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	36007983	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28849102, 29274137	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33905626	Stimulate	★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Prolapse	Tricuspid Valve Prolapse	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34326372	Associate	★☆☆☆☆ Found in Text Mining only
Ulnar polydactyly of fingers	Postaxial hand polydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	CTD_human_DG	19092814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18311384, 19004027	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25273091, 31435875	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	32635855	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	36791912	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	16928994		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16928994	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	16594992	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	22136666	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	9439661		★☆☆☆☆ Found in Text Mining only