TGFB1I1 (transforming growth factor beta 1 induced transcript 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7041
• Gene name: Transforming growth factor beta 1 induced transcript 1
• Gene symbol: TGFB1I1
• Synonyms (NCBI Gene): ARA55, HIC-5, HIC5, TSC-5
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022662	hsa-miR-124-3p	Microarray	18668037
MIRT029598	hsa-miR-26b-5p	Microarray	19088304
MIRT1421124	hsa-miR-2964a-3p	CLIP-seq
MIRT1421125	hsa-miR-4708-3p	CLIP-seq
MIRT1421126	hsa-miR-639	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IDA	10075738
GO:0003713	Function	Transcription coactivator activity	IMP	16624805
GO:0005515	Function	Protein binding	IPI	9756887, 12177201, 16330715, 16624805, 21900206, 21911467, 32707033
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	9422762
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7929412
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	18762808
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016331	Process	Morphogenesis of embryonic epithelium	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IDA	18762808
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0045165	Process	Cell fate commitment	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10075738
GO:0046872	Function	Metal ion binding	IEA
GO:0048495	Function	Roundabout binding	IPI	19855388
GO:0050681	Function	Nuclear androgen receptor binding	IPI	10075738
GO:0070161	Component	Anchoring junction	IEA
GO:0070411	Function	I-SMAD binding	IPI	18762808
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IDA	18762808

Other IDs

• MIM: 602353
• HGNC: 11767
• e!Ensembl: ENSG00000140682

Protein

• UniProt ID: O43294
• Protein name: Transforming growth factor beta-1-induced transcript 1 protein (Androgen receptor coactivator 55 kDa protein) (Androgen receptor-associated protein of 55 kDa) (Hydrogen peroxide-inducible clone 5 protein) (Hic-5)
• Protein function: Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signa
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	287 → 342	LIM domain	Domain
  PF00412	LIM	228 → 283	LIM domain	Domain
  PF00412	LIM	346 → 401	LIM domain	Domain
  PF00412	LIM	405 → 460	LIM domain	Domain
  PF03535	Paxillin	6 → 136		Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in platelets, smooth muscle and prostate stromal cells (at protein level). {ECO:0000269|PubMed:10075738, ECO:0000269|PubMed:10708479, ECO:0000269|PubMed:11311131, ECO:0000269|PubMed:12642630, ECO:0000269|PubMed:12772188, ECO:
• Sequence:

  MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
  STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
  ASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPT
  QPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
  TALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
  ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
  LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
  GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG

• Sequence length: 461

Related Genes

No strongly related genes found yet for TGFB1I1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TGFB1I1.