TGFB1 (transforming growth factor beta 1)

Gene

• Entrez ID: 7040
• Gene name: Transforming growth factor beta 1
• Gene symbol: TGFB1
• Synonyms (NCBI Gene): CED, DPD1, IBDIMDE, LAP, TGF-beta1, TGFB, TGFbeta
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800470	G>A,C	Risk-factor, benign	Coding sequence variant, missense variant
rs72480429	G>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs104894719	A>G	Pathogenic	Coding sequence variant, missense variant
rs104894720	C>T	Pathogenic	Coding sequence variant, missense variant
rs104894721	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894722	A>C,G,T	Pathogenic	Coding sequence variant, missense variant
rs111033611	A>G	Pathogenic	Coding sequence variant, missense variant
rs200164212	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs200482214	G>A	Pathogenic	Missense variant, coding sequence variant
rs281865483	->AGCAGCAGC	Pathogenic	Coding sequence variant, inframe insertion
rs281865484	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs281865485	G>C	Pathogenic	Missense variant, coding sequence variant
rs1057521741	G>C	Likely-pathogenic	Coding sequence variant, stop gained
rs1336387628	A>C,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1555755242	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1555755308	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1599893542	T>C	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005918	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20945401
MIRT006059	hsa-miR-29b-3p	ELISA, GFP reporter assay, qRT-PCR	21273536
MIRT006114	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	21991303
MIRT006059	hsa-miR-29b-3p	ELISA, GFP reporter assay, qRT-PCR	21273536
MIRT006114	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	21991303
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006059	hsa-miR-29b-3p	ELISA, GFP reporter assay, qRT-PCR	21273536
MIRT006114	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	21991303
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006791	hsa-miR-663a	Luciferase reporter assay, Western blot	22393947
MIRT030730	hsa-miR-21-5p	Microarray	18591254
MIRT030730	hsa-miR-21-5p	Microarray	18591254
MIRT037719	hsa-miR-744-5p	CLASH	23622248
MIRT053337	hsa-miR-211-5p	Luciferase reporter assay, qRT-PCR, Western blot	23726841
MIRT437865	hsa-miR-17-5p	qRT-PCR	23433743
MIRT437866	hsa-miR-19b-3p	qRT-PCR	23433743
MIRT438749	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT438206	hsa-miR-122-5p	qRT-PCR	24168656
MIRT438040	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438039	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438749	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT438206	hsa-miR-122-5p	qRT-PCR	24168656
MIRT438040	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438039	hsa-miR-93-5p	qRT-PCR	24367666
MIRT006791	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	27624777
MIRT006791	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	27624777
MIRT652731	hsa-miR-422a	Luciferase reporter assay, qRT-PCR, Western blot	27779704
MIRT731900	hsa-miR-422a	Luciferase reporter assay, qRT-PCR, Western blot	27779704
MIRT006059	hsa-miR-29b-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27895107
MIRT756323	hsa-miR-29b-1-5p	qRT-PCR, Western blot	27273381
MIRT030730	hsa-miR-21-5p	ELISA, qRT-PCR	26383248
MIRT053337	hsa-miR-211-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	32720595
MIRT733548	hsa-miR-486-3p	Immunofluorescence, Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34080770
MIRT733724	hsa-miR-30d-3p	Microarray, Western blotting	33917330
MIRT733725	hsa-miR-106a-3p	Microarray, Western blotting	33917330
MIRT006114	hsa-miR-144-3p	Microarray, Western blotting	33917330
MIRT733781	hsa-miR-542-3p	ELISA, Western blotting	33785768
MIRT733781	hsa-miR-542-3p	ELISA, Western blotting	33785768
MIRT733867	hsa-miR-425-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	33073700
MIRT734383	hsa-miR-26b-5p	qRT-PCR, ELISA	34185228
MIRT037719	hsa-miR-744-5p	Flow cytometry, Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	31643031
MIRT734616	hsa-miR-7641	Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32823722
MIRT736384	hsa-miR-494-3p	qRT-PCR	33247701
MIRT736453	hsa-miR-1343-3p	Western blotting, RNA-seq, qRT-PCR	33194007
MIRT737523	hsa-miR-21-3p	qRT-PCR, ELISA	33804922
MIRT737545	hsa-miR-1468-3p	Luciferase reporter assay, Western blotting, RNA-seq, Flow cytometry	32348937
MIRT737550	hsa-miR-133a-3p	Luciferase reporter assay, Western blotting, RNA-seq, Immunofluorescence, qRT-PCR	31511493
MIRT737566	hsa-miR-182-3p	Western blotting, qRT-PCR	32067333
MIRT737574	hsa-miR-744-3p	Luciferase reporter assay, Immunofluorescence, qRT-PCR, In situ hybridization, Flow cytometry	31643031
MIRT006791	hsa-miR-663a	Western blotting, qRT-PCR	31572558
MIRT037719	hsa-miR-744-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35593122
MIRT006791	hsa-miR-663a	Western blotting, qRT-PCR	35832307
MIRT734383	hsa-miR-26b-5p	qRT-PCR	34185228
MIRT756323	hsa-miR-29b-1-5p	Western blotting	38934067
MIRT1421108	hsa-miR-1908	CLIP-seq
MIRT1421109	hsa-miR-3180	CLIP-seq
MIRT1421110	hsa-miR-3180-3p	CLIP-seq
MIRT1421111	hsa-miR-3196	CLIP-seq
MIRT1421112	hsa-miR-3714	CLIP-seq
MIRT1421113	hsa-miR-3943	CLIP-seq
MIRT1421114	hsa-miR-4488	CLIP-seq
MIRT1421115	hsa-miR-4651	CLIP-seq
MIRT1421116	hsa-miR-4697-5p	CLIP-seq
MIRT1421117	hsa-miR-4708-3p	CLIP-seq
MIRT1421118	hsa-miR-4781-5p	CLIP-seq
MIRT1421119	hsa-miR-564	CLIP-seq
MIRT1421120	hsa-miR-608	CLIP-seq
MIRT1421121	hsa-miR-663	CLIP-seq
MIRT1421122	hsa-miR-744	CLIP-seq
MIRT1421123	hsa-miR-885-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ASH1L	Unknown	22488473
FOSB	Unknown	10843986
FOSL2	Unknown	10843986
JUND	Unknown	10843986
NFKB1	Unknown	16365456
SMAD3	Repression	19214138
SMAD4	Unknown	21968601
SMAD7	Activation	19214138
SP1	Activation	9580699
SP1	Unknown	22415074;2808430
STAT3	Activation	16474852
USF1	Activation	14757763
USF2	Activation	14757763
USF2	Unknown	15184388

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001657	Process	Ureteric bud development	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001763	Process	Morphogenesis of a branching structure	IEA
GO:0001775	Process	Cell activation	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	28373289
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	29529050
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	25893292
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	26451614
GO:0001843	Process	Neural tube closure	IEA
GO:0001843	Process	Neural tube closure	ISS
GO:0002028	Process	Regulation of sodium ion transport	IEA
GO:0002040	Process	Sprouting angiogenesis	IMP	31368162
GO:0002062	Process	Chondrocyte differentiation	IDA	15040835
GO:0002069	Process	Columnar/cuboidal epithelial cell maturation	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IDA	15451575
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	TAS	9639571
GO:0002460	Process	Adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains	IEA
GO:0002513	Process	Tolerance induction to self antigen	IEA
GO:0002859	Process	Negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	24586048
GO:0003179	Process	Heart valve morphogenesis	IEA
GO:0003179	Process	Heart valve morphogenesis	ISS
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	IMP	26634652
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IDA	11157754
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IEA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IMP	8167376
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IPI	1333888
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	26572508, 32644293
GO:0005125	Function	Cytokine activity	TAS	24263861
GO:0005160	Function	Transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	1326540, 2022183, 2119582, 7852346, 8370410, 8617200, 10092230, 10746731, 10885742, 10930463, 11157754, 15247411, 15864306, 17827158, 18672106, 19651619, 20505824, 20599762, 20856203, 20860622, 21054789, 21441952, 21677751, 25241761, 25416956, 25548275, 27339457, 28514442, 29909984
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	32644293
GO:0005615	Component	Extracellular space	IDA	19734317
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	18040277
GO:0005737	Component	Cytoplasm	IDA	18040277
GO:0005737	Component	Cytoplasm	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	19366691
GO:0006611	Process	Protein export from nucleus	IDA	17438144
GO:0006754	Process	ATP biosynthetic process	IDA	10513816
GO:0006796	Process	Phosphate-containing compound metabolic process	IDA	10513816
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006915	Process	Apoptotic process	IMP	3470709
GO:0006954	Process	Inflammatory response	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	12015308, 18548003
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9389648, 11157754, 12574355, 15334054, 18453574, 18593713, 18625725, 19736306, 26572508, 27693460, 28373289, 28467929, 31023188, 32644293
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	22714950
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	25196641, 26908446, 31368162
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007406	Process	Negative regulation of neuroblast proliferation	IEA
GO:0007435	Process	Salivary gland morphogenesis	IEA
GO:0007435	Process	Salivary gland morphogenesis	IEP	18080134
GO:0007492	Process	Endoderm development	IEA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0007565	Process	Female pregnancy	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	IMP	31368162
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10513816, 14633705
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26169693
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14555988, 15334054
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	11158066
GO:0008354	Process	Germ cell migration	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009611	Process	Response to wounding	IEP	18040277
GO:0009749	Process	Response to glucose	IEA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	IMP	19366691
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	TAS	19506300
GO:0010628	Process	Positive regulation of gene expression	IDA	18625725, 18832382, 18941241, 19913496, 25322725, 26634652, 26687115, 27162619, 28467929, 29167509, 31694982
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	22269326
GO:0010628	Process	Positive regulation of gene expression	IMP	26169693
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010628	Process	Positive regulation of gene expression	NAS	26451614
GO:0010629	Process	Negative regulation of gene expression	IDA	29529050
GO:0010629	Process	Negative regulation of gene expression	IDA	19913496, 20067797, 22269326, 25163461, 26634652, 28467929, 29167509
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	22269326
GO:0010629	Process	Negative regulation of gene expression	IGI	22269326
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	NAS	26451614
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	TAS	22269326
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	17999987, 18505915, 26572508
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	21490602
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	NAS	21319131
GO:0010742	Process	Macrophage derived foam cell differentiation	IC	15219857
GO:0010763	Process	Positive regulation of fibroblast migration	IDA	18555217
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IDA	20875417
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0014008	Process	Positive regulation of microglia differentiation	IEA
GO:0014008	Process	Positive regulation of microglia differentiation	ISS
GO:0016202	Process	Regulation of striated muscle tissue development	IEA
GO:0016202	Process	Regulation of striated muscle tissue development	ISS
GO:0019899	Function	Enzyme binding	IPI	19366691
GO:0021915	Process	Neural tube development	IEA
GO:0021915	Process	Neural tube development	ISS
GO:0030141	Component	Secretory granule	IEA
GO:0030214	Process	Hyaluronan catabolic process	IDA	17324121
GO:0030217	Process	T cell differentiation	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	15334054
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030334	Process	Regulation of cell migration	TAS	19018011
GO:0030335	Process	Positive regulation of cell migration	IDA	19736306
GO:0030335	Process	Positive regulation of cell migration	IMP	26169693
GO:0030424	Component	Axon	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0031012	Component	Extracellular matrix	HDA	23979707
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0031093	Component	Platelet alpha granule lumen	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031293	Process	Membrane protein intracellular domain proteolysis	IDA	25310401
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	19366691
GO:0031536	Process	Positive regulation of exit from mitosis	IEA
GO:0032355	Process	Response to estradiol	IDA	18039789
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IDA	18039789
GO:0032570	Process	Response to progesterone	IEA
GO:0032667	Process	Regulation of interleukin-23 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	18453574
GO:0032740	Process	Positive regulation of interleukin-17 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	25196641
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	32141990
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	32141990
GO:0032801	Process	Receptor catabolic process	IDA	17878231
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	22073128
GO:0032943	Process	Mononuclear cell proliferation	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	19734317, 22269326, 25310401
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IGI	22269326
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IMP	11158066
GO:0033280	Process	Response to vitamin D	IEA
GO:0034616	Process	Response to laminar fluid shear stress	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IMP	8167376
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	10885742
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IEA
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IMP	8167376
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IPI	10092230
GO:0035800	Function	Deubiquitinase activator activity	IDA	32644293
GO:0035902	Process	Response to immobilization stress	IEA
GO:0036446	Process	Myofibroblast differentiation	NAS	28095798
GO:0042098	Process	T cell proliferation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042306	Process	Regulation of protein import into nucleus	IEA
GO:0042306	Process	Regulation of protein import into nucleus	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	19366691
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042482	Process	Positive regulation of odontogenesis	IEA
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21677751
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IDA	21168935
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	25196641
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29203640
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	26572508
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	32644293
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IEA
GO:0045216	Process	Cell-cell junction organization	IDA	18505915
GO:0045216	Process	Cell-cell junction organization	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045589	Process	Regulation of regulatory T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEP	19357233
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	15040835
GO:0045662	Process	Negative regulation of myoblast differentiation	IDA	9770491
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	18625725
GO:0045786	Process	Negative regulation of cell cycle	IDA	11502704
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15702480, 18832382
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9389648, 14517293, 15334054
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12574355, 18832382, 22073128
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048298	Process	Positive regulation of isotype switching to IgA isotypes	IDA	14988498
GO:0048535	Process	Lymph node development	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0048565	Process	Digestive tract development	IEA
GO:0048642	Process	Negative regulation of skeletal muscle tissue development	IDA	9770491
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	28467929, 31023188
GO:0048839	Process	Inner ear development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	9950587
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IMP	16943770
GO:0050714	Process	Positive regulation of protein secretion	IDA	18505915
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	32141990
GO:0050765	Process	Negative regulation of phagocytosis	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050921	Process	Positive regulation of chemotaxis	IDA	18555217
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051152	Process	Positive regulation of smooth muscle cell differentiation	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IDA	15219857
GO:0051280	Process	Negative regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18625725
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	IEA
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0055091	Process	Phospholipid homeostasis	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060312	Process	Regulation of blood vessel remodeling	NAS	22269326
GO:0060312	Process	Regulation of blood vessel remodeling	TAS	22269326
GO:0060325	Process	Face morphogenesis	IEA
GO:0060364	Process	Frontal suture morphogenesis	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	9389648, 17438144, 17999987, 18453574, 19366691, 19736306, 25196641, 25893292, 26634652, 27693460, 28467929, 29167509, 31023188
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IGI	22714950
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	26908446
GO:0060435	Process	Bronchiole development	IEA
GO:0060744	Process	Mammary gland branching involved in thelarche	IEA
GO:0060751	Process	Branch elongation involved in mammary gland duct branching	IEA
GO:0060762	Process	Regulation of branching involved in mammary gland duct morphogenesis	IEA
GO:0061035	Process	Regulation of cartilage development	IEA
GO:0061298	Process	Retina vasculature development in camera-type eye	IEA
GO:0061448	Process	Connective tissue development	IEA
GO:0061520	Process	Langerhans cell differentiation	IEA
GO:0070168	Process	Negative regulation of biomineral tissue development	IDA	26634652
GO:0070168	Process	Negative regulation of biomineral tissue development	IEA
GO:0070173	Process	Regulation of enamel mineralization	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	25310401
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IMP	32141990
GO:0071456	Process	Cellular response to hypoxia	IMP	31368162
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	19736306, 22269326
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IGI	22269326
GO:0071677	Process	Positive regulation of mononuclear cell migration	IEA
GO:0071895	Process	Odontoblast differentiation	IEA
GO:0071895	Process	Odontoblast differentiation	ISS
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0085029	Process	Extracellular matrix assembly	IDA	19734317
GO:0085029	Process	Extracellular matrix assembly	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	12893825, 15040835
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	25605017
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	15334054, 26572508
GO:0097421	Process	Liver regeneration	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0141091	Process	Transforming growth factor beta receptor superfamily signaling pathway	IEA
GO:1900126	Process	Negative regulation of hyaluronan biosynthetic process	IDA	17324121
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26634652
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IEA
GO:1901203	Process	Positive regulation of extracellular matrix assembly	ISS	24279830
GO:1901203	Process	Positive regulation of extracellular matrix assembly	NAS	27098600, 28095798
GO:1901203	Process	Positive regulation of extracellular matrix assembly	TAS	22269326
GO:1902074	Process	Response to salt	IEA
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IGI	22714950
GO:1902893	Process	Regulation of miRNA transcription	IMP	18548003
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	25605017
GO:1902894	Process	Negative regulation of miRNA transcription	NAS	26451614
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	26311719, 26493107
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IDA	21168935, 24586048
GO:1904018	Process	Positive regulation of vasculature development	IDA	27693460
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	28467929
GO:1905005	Process	Regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905641	Process	Cellular response to acetaldehyde	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:1990402	Process	Embryonic liver development	IEA
GO:1990402	Process	Embryonic liver development	ISS
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	18593713
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IMP	32141990
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	32141990
GO:2000636	Process	Positive regulation of primary miRNA processing	IDA	18548003
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IDA	25163461

Other IDs

• MIM: 190180
• HGNC: 11766
• e!Ensembl: ENSG00000105329

Protein

• UniProt ID: P01137
• Protein name: Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide (LAP); Transforming growth factor beta-1 (TGF-beta-1)]
• Protein function: Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively. {ECO:00002
• PDB: 1KLA, 1KLC, 1KLD, 3KFD, 4KV5, 5FFO, 5VQP, 6OM2, 6P7J, 7Y1R, 7Y1T, 8UDZ, 8VSC, 8VSD, 9FDY, 9FKP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00688	TGFb_propeptide	29 → 261	TGF-beta propeptide	Family
  PF00019	TGF_beta	292 → 389	Transforming growth factor beta like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in bone (PubMed:11746498, PubMed:17827158). Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA) (PubMed:11746498, PubMed:17827158). Colocalizes with ASPN in chondrocytes
• Sequence:

  MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
  SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
  YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
  YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
  TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
  DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
  LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

• Sequence length: 390

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
CAMURATI-ENGELMANN DISEASE 1	Likely pathogenic; Pathogenic	rs104894720	RCV005867746	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diaphyseal dysplasia	Pathogenic; Likely pathogenic	rs104894719, rs104894720, rs104894721, rs111033611, rs104894722, rs1599893542	RCV000013354 RCV000013355 RCV000013357 RCV000013358 RCV000013359 RCV000990219	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Encephalopathy	Likely pathogenic	rs1555755308, rs1555755242, rs1336387628	RCV000584758 RCV000584755 RCV000584756	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IL10-related early-onset inflammatory bowel disease	Likely pathogenic	rs1555755308, rs1555755242, rs1336387628	RCV000584758 RCV000584755 RCV000584756	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inflammatory bowel disease, immunodeficiency, and encephalopathy	Likely pathogenic	rs2513384226, rs1555755308, rs1555755242, rs1336387628	RCV004547204 RCV000723358 RCV000723357 RCV000723356	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE INSUFFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APHTHOUS STOMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, GOUTY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERYLLIOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast cancer, invasive, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAMURATI-ENGELMANN DISEASE	—	GWAS catalog, HPO, Orphanet GWAS catalog, HPO, Orphanet GWAS catalog, HPO, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAMURATI-ENGELMANN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL DISC DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF CARTILAGE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPPER-OVERLOAD CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLING ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic fibrosis	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar CTD, ClinVar, Disgenet, GWAS catalog, Orphanet CTD, ClinVar, Disgenet, GWAS catalog, Orphanet CTD, ClinVar, Disgenet, GWAS catalog, Orphanet CTD, ClinVar, Disgenet, GWAS catalog, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROMES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC INSUFFICIENCY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION, INFLAMMATORY BOWEL DISEASE, ARTHRITIS, RECURRENT INFECTION SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERVERTEBRAL DISC DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meckel syndrome, type 10	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCCUPATIONAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOCHONDRODYSPLASIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS, POSTMENOPAUSAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONEAL FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLEURAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC AORTIC REGURGITATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS, PULMONARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TGFB1-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTHEMIA, ESSENTIAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	19937367, 25738867		★☆☆☆☆ Found in Text Mining only
Acromicric Dysplasia	Acromicric Dysplasia	CTD_human_DG	18677313		★☆☆☆☆ Found in Text Mining only
Acromicric dysplasia	Acromesomelic dysplasia	Pubtator	18677313, 21683322	Associate	★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	16307809		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22465044, 24558424, 24737521		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	12041672		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	1544940, 1895755, 2590216		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28373582		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	10469268		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28732737, 28917156, 30453100, 30997931		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	11703351		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	24463810		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	21509626, 27975299, 29517633		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11014898, 7504151		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11195465, 16499994, 16921482, 17018615, 23030255, 24258346, 28898237, 7794080, 8253361, 8358733, 8606485, 8770984, 9119258, 9387902		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12794244, 14607699, 15184872, 16499994, 16921482, 17018615, 18506891		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	17418594		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	12893005, 25417197, 29966518, 8358733, 9119258		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16921482, 17018615		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30556866, 31611981		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10071036, 10232601, 12379307, 12399125, 16900348, 20506050, 23146760, 24140887, 25928368, 26212008, 26582240, 28521455, 28534939, 28610976, 30609689, 30712885, 30783512, 31088909, 31562393		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11212248, 29165389		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11707452, 1457126		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	17418594		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	23176363		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	17418594		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	17418594		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25485635		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10416598, 10985498, 11081197, 17214746, 17394006, 8077617, 9387902		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17615257		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17615257, 22396040, 9387902		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18774639, 29956755, 7970729		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	LHGDN	17394006		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25409617, 27267807		★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	24380766	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23866946	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	11925630, 16162149, 22902304, 30186412		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28732737, 30453100		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	29307605		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	22724518		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	17644739		★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	BEFREE	21541994		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	18467597, 20514018, 2358774, 25358858, 9209305		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18467597		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	10637094, 9143260		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26310622, 28973964		★☆☆☆☆ Found in Text Mining only
Aggressive Systemic Mastocytosis	Systemic Mastocytosis	BEFREE	25480330		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15120189, 26316419, 26708394, 28401852, 30446828, 31535402		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	23579771, 31750952		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	8721483		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	8721483		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	22697347		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	23748277		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	15286001, 16324872, 16365456, 17266442, 19817698, 24762191, 26817844		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12000710, 15834029, 17889927, 21368376, 24731980, 28557134, 32309439, 34705667	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21741294	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	8879214	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	24347181		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21924590		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	32879156	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	35627273	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10623661, 25101849, 29283464, 30248366		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	17285762		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	25634178, 31107959, 34767750	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27756506, 28712846, 31394426		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12466133, 24662832, 27041581, 28032372, 28781950, 30138414, 30632705, 31072570		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12417722		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	16288728, 27356491, 28386367		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	11300459	Stimulate	★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	25313366	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	23446766, 26758901		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	12397096, 19277688, 21167691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	15860935, 18474728		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	38022547	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	10606887	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	26214243, 27933374, 32590737	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	30784322	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	18187665, 24391023, 26508723, 27026283, 33062074	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24391023, 26928604, 27756506		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	27926867	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	12787696, 19672284, 22955109, 23291965, 24768363, 27720318, 28679693, 29165337, 31147528, 34185228, 35909487, 37864304	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	10475771	Inhibit	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	10475771	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	24533640	Associate	★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	31725165		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	12890863, 15479754, 15769917, 21833528		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	15086490, 21126344	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	12467210, 19435915, 21109948, 21624123, 21697762, 22699812, 23157946, 23552743, 24378395, 24670043, 25724625, 26279302, 26915435, 27492861, 27542226, 27671303, 27840243, 27895310, 28608476, 29039574, 29165389, 30944652, 31109321, 31177911, 31199988, 31234517, 31702018		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	22761868, 24670043, 26586478	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anterior subcapsular cataract	Subcapsular cataract	BEFREE	15161862, 16360653		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	27556453		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28810156		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27543835		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27543835		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	19299629, 20067609, 23099432, 23291965, 25465469, 29174139, 30006123, 35052435	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	20829218, 23993239, 27389586		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	31147528	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	12787696, 23538006, 24768363, 26027897	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	19672284, 20829218, 21448509, 23099432, 24707114, 25835445, 26017485, 27146836, 27298013, 27394642, 37445606, 37894814	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracoabdominal	Thoracoabdominal aortic aneurysm	Pubtator	10709066	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	15698546, 19434696, 19897194, 26027897, 31144100		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic disease	Pubtator	19744994	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	12787696, 24720641	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	25113270, 25835445, 27146836, 27632686, 28679693, 35307021, 35971448, 37226099, 40139558	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	26634652, 29581213		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	CTD_human_DG	21216836		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	11300459, 20041033, 28420669, 9264495		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	35181609	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	20953611, 24362456, 26214243		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	27380173	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	20124997, 28665611		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	20124997	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Tortuosity Syndrome	Arterial tortuosity syndrome	Pubtator	24193348, 26376865	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11786115, 15910294, 16804000, 20511416, 21167485, 21679448, 24819318, 25592103, 25740578, 26054589, 26830200, 27234600, 27986445, 28434000, 29152651, 29705699, 30233664, 30380512, 30687328, 30942415, 31467123		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	21862019	Inhibit	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	35393474, 36198763	Associate	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	21737283		★☆☆☆☆ Found in Text Mining only
Arteritis	Arteritis	Pubtator	22955109	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	10088774, 26518873, 30320351	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12723985, 16564576, 30508140, 9637694		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	1914237	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	39259129	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	7722463	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	21740541, 23121667, 24782191	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	1908092, 36672844	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	36997896	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10343777, 11966774, 12176809, 12384915, 15695537, 17200409, 1747946, 17594488, 18721452, 1908092, 19192274, 19279017, 19886735, 20380722, 20628268, 21740541, 2201470, 22513132, 24989895, 26147289, 27626941, 27667787, 28751821, 30046030, 30657547, 30839312, 31498070, 31991837, 34911836, 35603149, 35798734, 36233253, 37496411, 8608632	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1914237, 28376277, 34301999	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26518873, 32543888, 36233253	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12563678		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	25934826		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10224407, 11810274, 12370400, 14597484, 15120189, 15753900, 15943594, 15947480, 16364194, 16387590, 16387593, 16916603, 17333284, 17369289, 17651146, 17673695, 17892594, 17921359, 18036644, 18425216, 19046298, 19096005, 19136038, 19153535, 19168696, 19222424, 19331718, 19393328, 19657898, 19745160, 19910030, 20409029, 20485865, 20599261, 20607798, 20683101, 21749458, 21819759, 21908588, 22015454, 22053598, 22206775, 22270542, 22498476, 23466425, 23563034, 24243740, 24269701, 25119113, 25240764, 25359706, 25721048, 25759826, 26656423, 27081784, 27297409, 27627560, 27639060, 27696149, 27717847, 27799535, 27807906, 27854509, 27905842, 27916734, 28262390, 28284979, 28826527, 28978148, 28984468, 29104662, 29343695, 29399106, 29656209, 29843083, 29958018, 30088373, 30092299, 30362537, 30472056, 30479079, 30742476, 30810068, 30903795, 31709879, 31733831, 31780948, 8810646, 9308919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	10893219, 12370400, 14523040, 1575583, 16365456, 17202225, 17333284, 17369289, 17673695, 19043669, 19153535, 19539983, 19733294, 19857272, 19910030, 20386084, 20511342, 20573231, 20660732, 20683101, 20926789, 21430262, 21799075, 21849067, 22053598, 22192168, 22865549, 23563034, 23884466, 23944957, 24782592, 25119113, 25360780, 25721048, 25759826, 26112417, 26656423, 27297409, 27461979, 27627560, 30021811, 30472056, 30676129, 30742476, 30903795, 31586488, 32065213, 32155894, 32900903, 33032603, 33245228, 33510050, 33808110, 34737220, 34876240, 35190755, 35774789, 36550650, 36835202, 37175437, 38375886	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12170265, 16690986, 17333284, 17369289, 17673695, 18359288, 18802103, 19043669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	16365456, 19138248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	21170080, 21908588, 22206775, 22227561, 24067469, 25148800, 28284979, 30038057, 36834879	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26546895, 27221564	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	CTD_human_DG	25721048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	12414124, 25333259		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23947815, 34162919	Associate	★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	16916603		★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	27756506		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10400038, 10749696, 11786115, 11849456, 12039487, 15800982, 16733295, 17591977, 21679448, 24495866, 24819318, 25119113, 25250731, 25720609, 25826292, 25880731, 32245324, 33942489, 37175608, 40649979, 7747808, 8675633, 8985146, 9410894	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11786115, 15910294, 16804000, 20511416, 21167485, 21679448, 24819318, 25592103, 25740578, 26054589, 26830200, 27234600, 27986445, 28434000, 29152651, 29705699, 30233664, 30380512, 30687328, 30942415, 31467123		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	14699019, 15200451, 17591977		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20954112, 27999237	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30942415	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18322650, 20075334, 20356380, 23465222, 24144036, 24349426, 24454806, 25402477, 25422138, 25796343, 27447370, 28323847, 28495464, 29096943, 29233682, 29245016, 29324263, 29390467, 29535140, 29671258, 30153670, 30239604, 30683806, 30697920, 30894138, 31173317, 31391207, 31393025, 31447893, 31707807, 31841207		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	20235205, 20356380, 24144036, 24349426, 25402477, 25422138, 26261573, 26774166, 28323847, 30153670, 30697920, 31173317, 33421993, 33681892, 34549527	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	22412222, 24454806, 35348192	Stimulate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	31474744		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	31474744		★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	Pubtator	15358693	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	12641657, 14717921	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	15834029, 23457231, 28557134		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28344757	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29298441, 29571898, 30221723, 31474744, 31530087		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23231720, 33839306, 34050248	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30221723		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	19962351		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10648114, 11727511, 15880049, 16137611, 17911416, 17977791, 21317396, 23645040, 24056369, 28637902, 28695870, 29289685, 30070177, 30316032, 30947570, 31118160, 31149046		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11309160, 12754205, 15800982, 16385528, 24799764, 28103949, 33837229, 36834770, 8697616	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12560464	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	1575583	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	1575583	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	30784322		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	26553048, 26915797		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	29483653		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	15927846		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	17339425, 20017807, 22621932, 30272252, 31336121, 31392383, 31640181, 7478586, 8562941		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16368780, 19468668, 20080664, 21305538, 24714516, 26447543	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16921482, 19468668		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	18024258		★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	20655547		★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	18925687, 24984193, 31885007	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	19796538, 22935165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	35455984	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	BEFREE	9616289		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	14604900, 15599946, 16461080, 1689483, 18058470, 18619832, 19829035, 21321977, 28493523, 28735516, 29988032, 31694982, 7521962, 7522082, 8602397, 8606485, 8973690		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	9192977	Stimulate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	23790953		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	25113270, 25745062, 26420484, 28420669, 28666329		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	21448509, 27298013, 27394642, 29165337	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	19878580	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	26909983, 30159734		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	26909983, 9708812	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	30026087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary cirrhosis	Biliary cirrhosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	30026087		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	23298711		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	17470130	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11723175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11723175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder neck obstruction	Bladder neck obstruction	BEFREE	25451078		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10208456, 16046050, 16301119, 19004027, 23970096, 25017509, 25722217, 25728352, 26048435, 26152796, 28839463, 29349903, 29923283, 30262086, 30823924, 31413591, 7609100, 7736402, 9192977		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16301119		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	26658659	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	29167193, 30036769, 30230348		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10750555, 10780855, 11278244, 11590145, 11701443, 11918080, 12493741, 17900349, 18435575, 20308061, 21116815, 21740541, 22071418, 22629385, 25793716, 25808168, 39363898	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	18435575, 25501632		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23378237, 26667932	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Developmental	Bone disease	Pubtator	36339419	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	10780855, 21124921, 25565391	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	11810278, 23729546		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19201832	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	21189329, 31211692	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	12459458, 37993664	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	11701443, 25278075, 27279422, 36325441, 36482064	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	12933809	Inhibit	★☆☆☆☆ Found in Text Mining only
BORNHOLM EYE DISEASE	Bornholm Eye Disease	BEFREE	14725365		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	29483653		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	29483653, 30468562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries	Brain injuries	Pubtator	26867675	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	23511211	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	23582094	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	12560464, 14669355, 23840623, 38256406, 39388865	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25966122		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	1390899, 16900348, 7729516		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10470853, 10482694, 10521925, 10839458, 11401606, 11473365, 12386814, 12569017, 14607332, 14871809, 15006917, 15056732, 15082097, 15305380, 15803361, 15833881, 15878096, 15941974, 15945506, 15949894, 16457687, 16959612, 17018785, 17032147, 17035001, 17293864, 17668048, 17721995, 17848193, 17965799, 18161870, 18299279, 18348656, 18523885, 18676771, 18827819, 18932017, 19079339, 19092773, 19582787, 19914962, 20096948, 20143152, 20154716, 20157775, 2021547, 20232138, 20309626, 20349130, 20349216, 20361250, 20506050, 20545612, 20576088, 20640597, 20845106, 21099351, 21829601, 22079734, 22100658, 22248507, 22436421, 22647687, 2295070, 23001908, 23054396, 23067574, 23129177, 23516540, 23887657, 23982878, 23996684, 24036252, 24036662, 24121667, 24146803, 24164868, 24425107, 24457988, 24618085, 24740564, 25109336, 25327287, 25374198, 25531323, 25572132, 25961925, 26138318, 26232605, 26419593, 26431436, 26482896, 26520789, 26716641, 26718214, 26896736, 27036297, 27178816, 27519288, 27751807, 27863394, 27867016, 28042775, 28078601, 28159748, 28263968, 28286736, 28288400, 28407692, 28418877, 28542577, 28599447, 28722137, 28734865, 28892081, 28902348, 28993429, 29050223, 29113242, 29151919, 29187452, 29328467, 29362917, 29414799, 29557524, 29658391, 29717397, 29796175, 29809196, 30004628, 30012949, 30027292, 30128014, 30252131, 30275854, 30340644, 30570851, 30848576, 30901941, 31082421, 31142059, 31178227, 31247718, 31313132, 31405342, 31464639, 31470867, 7490677, 8390290, 8669837, 9148862, 9626349		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	32365829, 34261476	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10993898, 11158583, 11444526, 11555647, 11590145, 11994274, 12163372, 12459458, 12461787, 12747808, 14739340, 15155736, 15520018, 15566434, 15878096, 16457687, 16627986, 17028091, 17325707, 17382930, 17761946, 17848193, 18164268, 18434084, 18523885, 18625718, 18625725, 18827819, 19241157, 19451693, 19838175, 1985102, 19914962, 19937272, 19943940, 19955655, 20054641, 20086175, 20096948, 20154716, 20332227, 20506050, 20576088, 20605201, 20688878, 20930144, 21047769, 21099351, 21194473, 21364658, 21527583, 21564419, 21596841, 21779361, 21829601, 21930940, 21935711, 21992556, 22028892, 22126971, 22144583, 22260435, 22286770, 22353218, 22436421, 22539603, 22618884, 22629385, 22941282, 23001908, 23022998, 23053665, 23067574, 23098454, 23208498, 23295955, 2331446, 23333936, 23349840, 23396049, 23441215, 23479725, 23770854, 23840623, 23887657, 23996684, 24036252, 24036662, 24121667, 24143895, 24146803, 24235142, 24335925, 24337772, 24377611, 24425107, 24586338, 24610082, 24638085, 24648515, 24658161, 24740564, 24890385, 25130457, 25344051, 25379550, 25380580, 25499443, 25555875, 25572132, 25658913, 25670079, 25744371, 25756394, 25813152, 25824321, 25867965, 25871474, 25992978, 26040677, 26160166, 26267863, 26431436, 26482896, 26561471, 26597083, 26660119, 26703884, 26749136, 26758191, 26805406, 26862846, 26919310, 26984519, 27014911, 27019625, 27036021, 27135253, 27197167, 27208428, 27589056, 27626636, 27651382, 27733130, 27806311, 28054666, 28060811, 28272713, 28337662, 28403546, 28542577, 28683467, 28738804, 28852133, 28902348, 28982386, 29051564, 29101386, 29193730, 29215776, 29320969, 29362917, 29405562, 29526821, 29724812, 29804124, 29893810, 30004628, 30027292, 30468476, 30483746, 30513096, 30570851, 30579251, 30579865, 30594253, 30710426, 30848576, 30887707, 30989460, 31041842, 31140748, 31142059, 31178227, 31247718, 31263129, 3135043, 31405342, 31529614, 31557971, 31558321, 31597263, 31681835, 31746388, 31991851, 32013934, 32196606, 32345959, 32350443, 32934344, 33023154, 33050781, 33234595, 33271824, 33568351, 33579826, 33626035, 33667790, 33754901, 33767579, 33932112, 34059749, 34093853, 34096887, 34181349, 34215226, 34239022, 34261476, 34297787, 34362391, 34644733, 34714340, 34810279, 34974534, 35101033, 35332839, 35381768, 35395809, 35484112, 35538070, 35937944, 36401368, 36506936, 36604141, 36646950, 36691073, 36696357, 36825546, 37682272, 37682817, 37685980, 37870468, 37958964, 38105247, 38153734, 38219710, 38220208, 38245723, 39351229, 39468555, 40303493, 7539790, 7543740, 7729516, 8198961, 8390290, 8393616, 8407955, 8519657, 8630288, 8805931, 9101366, 9139748, 9632722	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20562526, 26520789, 26976638, 27329104, 32543888, 36928924, 39180088	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26919241, 28726720, 29713003, 3128508, 31766464, 9885238	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	12635140, 23776649		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	23776649, 27409985	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	10885424	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	10885424, 20632031		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis obliterans	Pubtator	20497023	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	LHGDN	14720431		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	14633629, 15333328, 16952379, 18614962, 18756046, 19778283, 25591994, 28046032, 29242152, 30001393, 30789824		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	18756046, 24828686, 30001393, 33552042	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	35382780	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	30563499		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	12366695, 12558956		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10811940, 7478586, 7636179, 8562941		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10846060, 10946276, 11062049, 11160743, 19022773, 19136942	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	28288584	Stimulate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	31273954	Associate	★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	25190493	Associate	★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	29536621	Stimulate	★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	25190493		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	18303197, 35808901	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	36787443	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	10063832, 20655547		★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann disease	Camurati-Engelmann Disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	10631145, 10973241, 11062463, 11278244, 11807860, 11810278, 12493741, 12843182, 15326622, 15894597, 17433803, 19654961, 21541994, 23453470, 23503840, 23729546, 23824952, 25099136, 27484238, 27928112, 27959412, 30091466, 30690794		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	UNIPROT_DG	10973241, 11062463, 12493741, 12843182, 15103729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	GENOMICS_ENGLAND_DG	11062463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	LHGDN	17433803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer Pain	Cancer	Pubtator	18563556, 33522069	Associate	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	36494335	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10333714, 10757810, 10777512, 10947082, 11253131, 11444526, 11555647, 12011061, 12237773, 12353499, 12747808, 1370826, 15155736, 16135802, 16368780, 16478646, 16603637, 16884377, 16886611, 17264880, 17695423, 17890272, 18158922, 18160707, 18422752, 18426913, 19096149, 19383239, 19698122, 21068203, 2108318, 21305538, 21360479, 21365634, 21625455, 21984931, 22013049, 22286770, 22799322, 23001908, 23236396, 23504025, 23651589, 23974105, 23991075, 25205100, 25207642, 25338997, 25542272, 25682975, 25813152, 25890285, 25928368, 25992978, 26846663, 26852921, 26862846, 26919310, 27383203, 27479195, 27759037, 28314256, 28418896, 29065973, 29406185, 29690860, 29955155, 29991755, 29995950, 30071009, 30137431, 30848576, 31344058, 31570856, 31831717, 32439976, 32574835, 32667519, 33062039, 33308241, 33482222, 34037532, 34070531, 34073989, 34218518, 34571856, 35075245, 35395809, 35490194, 35605790, 35743003, 35798776, 37774061, 38256406, 39907411, 40303493, 8054266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11267935, 17875706, 26226105	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33168592	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10562360, 10601563, 11408925, 11606077, 11684442, 11910473, 12032856, 12174910, 12514788, 12692838, 15386352, 15629771, 19724928, 2295065, 23056402, 24973511, 25544767, 27733130, 31242633, 9183654, 9192977, 9626349		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12417722		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	22641218	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25485635, 29424489	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27117439	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16101174, 16627986, 38247878	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	30989460	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10438468, 10490821, 10611320, 11257503, 12107103, 12593671, 15294900, 15509538, 15546505, 15777850, 16489684, 16617361, 17006932, 1703520, 18092051, 18644981, 19169878, 19426152, 19723656, 20196115, 20346216, 20467172, 20471435, 20531292, 20602797, 21499307, 2161812, 22178269, 22563190, 22732936, 23185371, 23464434, 23499802, 23653379, 23826206, 23991075, 24023784, 24223834, 24324363, 24512821, 24637780, 24761872, 24806207, 25087096, 25162823, 25251599, 25342595, 25503443, 25523445, 25880619, 25959919, 25966218, 26057631, 26110787, 26158762, 26165819, 26290635, 26404322, 26449823, 26462837, 26573807, 26648552, 27111394, 27121309, 27236156, 27292026, 27475525, 27556509, 27581744, 27862334, 28192402, 28230858, 28245423, 28283039, 28423507, 28492136, 28678325, 28918914, 28963738, 28965351, 28970582, 29022911, 29115395, 29230000, 29487329, 29515105, 29690860, 29882900, 29958417, 29991878, 30070319, 30191377, 30536311, 30537113, 30670911, 30723271, 31089680, 31264769, 31465839, 31499614, 31558875, 31568519, 31739702, 31905709, 32148378, 32160402, 32218692, 32307580, 32318691, 32324847, 32471991, 32585841, 32904434, 32945410, 33199679, 33426064, 33992698, 34053234, 34073989, 34093861, 34104078, 34117368, 34281492, 34338154, 34571856, 34651050, 34711009, 34712379, 34769191, 34825776, 35123494, 35567547, 35578690, 35610614, 35765089, 36215278, 36303180, 36447138, 36466817, 36581319, 36680322, 37195148, 37463530, 39346898, 40339499, 7639583, 7850892, 8389483, 9020892, 9652391	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11242803, 27268609	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24960176, 28076850	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18685848	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	31595577	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	37175975	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16046050, 19004027, 19669587, 21429769, 23970096, 25017509, 25722217, 25728352, 26048435, 26152796, 27350089, 28839463, 29349903, 29923283, 30262086, 30823924, 31413591, 7609100, 7736402, 9192977		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	22901175		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11195465, 11506965, 15823505, 16499994, 16875935, 17654453, 18759245, 19349911, 21360479, 22393947, 22675434, 22946048, 23022171, 23127773, 23137649, 23146760, 23223528, 23290789, 23545945, 23802127, 23840350, 24098479, 24121493, 24134845, 24140887, 24573038, 24642488, 25409890, 25433501, 26212008, 26297431, 26514616, 27178816, 27470220, 27543359, 28028969, 28075456, 28266181, 28412214, 28446126, 28472762, 28610976, 28629532, 28693227, 28782471, 28804523, 28872461, 28898237, 28918673, 29113195, 29118814, 29268507, 29306075, 29407170, 29408308, 29952428, 30346081, 30568457, 30574760, 30783512, 30848226, 30940659, 30988806, 31015163, 31038242, 31344049, 31492158, 31501278, 31581360, 31764821		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10689548, 11531253, 21799915, 22138668, 24310505, 24452274, 24986540, 25307974, 26091707, 27118139, 28427435, 28623900, 29751820, 30485902	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21614520	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	16101174, 17876328, 21624123, 21768661, 22869556, 23157946, 24378395, 24465802, 24500968, 25418581, 26284758, 26586478, 26588899, 27604902, 27895310, 28608476, 31177911, 31350453, 31702018, 32291413, 32376602, 32467989, 33782384, 35151689, 35634239, 35743003, 35810469, 36207615, 36329620, 36582601, 36587397, 36881486, 36949954, 37086509, 37241104, 37653101, 38057506, 39212293, 39518973	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22190968	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11171960, 12657102, 17279417, 19922630, 20208565, 21209004, 21826227, 24704995, 25381221, 25909813, 26713736, 27166254, 27619681, 27806310, 27812180, 28004769, 28710314, 29138866, 29406185, 29700419, 30275756, 30379886, 32596961, 33725966, 35179216, 35945219, 36310399, 36313180, 36505457, 38148073, 39971624, 40256740, 7656270, 9486416	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24899691, 26848077, 31181623	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35350785	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	17469181	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14970860, 15161003, 15247230, 15736400, 19383239, 19387481, 20179236, 21170261, 22002724, 22718118, 2478181, 25579378, 25813410, 27169370, 28102840, 28886030, 28898237, 29463556, 29934580, 30249756, 30535430, 30910843, 31695056, 32124963, 33482222, 34263914, 35799269, 36012449, 37806311, 39245357, 8327510	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	8439507	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	18451156, 8763422		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	17418594		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	12770737, 23176363		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	17418594		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10226576, 11376559, 15863158, 19854294, 21614520, 22421944, 26501435, 27322208, 28611202, 29017822, 29048644, 29130097, 29537103, 29751820, 30087253, 30158641, 30375371, 30485902, 30594239, 30814239, 31180557, 31435668		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12417722		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	15937546		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	20664947, 22139024, 22447164		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	CTD_human_DG	15132766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinosarcoma	Carcinoma	Pubtator	25918253, 37169340	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	12182464, 28553282, 29922960, 31689135, 9493904		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112, 26771187, 30115125, 33016206, 37526028	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25298166	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16095497, 21422001, 25298166	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17635914, 26918958, 28399937, 33407844, 37268658, 37345811, 37840136	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	28207945	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	11782760, 21920670, 25871499, 27569062, 31180540, 34192899, 34946964, 36252118	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	24716596, 25973737, 31409892, 35406794	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	11557193, 11803605		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10351968, 11345133, 16204268, 25753859, 27448535, 29115435, 29568948, 30371322, 30489003, 31338905		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	28679693	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11786115, 12812985, 15200451, 15593053, 15910294, 21685787, 22100658, 28595793, 29186866, 31227975, 31382626, 31778596		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	11786115, 15200451, 18821144, 21309044, 31520610, 32239175, 34807419, 37562580, 38256034, 40649979	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15593053, 17485238		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	24378993, 35937796	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	16804000		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	37121730	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	24014274, 34224495	Stimulate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	25073432, 28120574, 30243295, 30927912, 32317146	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	30927912		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	17827158, 22241609, 22883423, 24034904, 26395178, 29374435, 30677026, 32319543	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	30677026	Stimulate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	34686774	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10440257, 16360653, 17525203, 22128246, 22410565		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	19001221, 22128246, 27415760, 37203095, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	35379202	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	12410804		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16287542, 31718200		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	18064301, 28879170, 37047806	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31115370	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	34449925	Inhibit	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	2007861, 29483653	Associate	★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	10587400, 11700497, 19560950		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	CTD_human_DG	12634787		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	BEFREE	23734748		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	20054641	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	15834029		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	15834029, 28557134	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	29483653		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Autosomal Recessive Arteriopathy with Subcortical Infarcts and Leukoencephalopathy	Vascular leukoencephalopathy	BEFREE	25772074, 28470822		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	33955515	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral hemorrhage with amyloidosis, hereditary, Dutch type	Cerebral Amyloid Angiopathy	BEFREE	28557134		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	21679448, 21885147, 28254431, 29704604, 30535466, 7595653		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	21679448, 22769019	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	19788865, 32239807	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	21320870		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	12374626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	14514014, 17023672, 29396549, 30120034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	16990569		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	11786115, 21679448, 26621360, 9761057		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	15200451, 21679448, 33050491, 33942489, 37459093	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12358852, 12514788, 15386352, 15797633, 16269171, 17332318, 17549406, 19911703, 21468579, 23873179, 24195511, 26769181, 27010470, 27220278, 27748903, 28906311, 29852177, 30301599, 31435875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	11113867, 15797633, 17503414, 17549406, 19614955, 7835777		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12358852, 12514788, 15386352, 15797633, 16269171, 17332318, 17549406, 19911703, 21468579, 24195511, 26769181, 27010470, 27220278, 27748903, 27916907, 28906311, 29852177, 30301599, 31435875, 7835777, 9648593		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19229971, 28732737, 30453100		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	29307605		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	17333284, 19096005, 19657898, 28262390		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	22724518		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10869285, 12615726, 16792547, 20489148, 26441331, 27364974		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15696189, 22068819, 24935374, 25526346, 25993985, 26077733, 26441331, 29084594, 29510695, 29569474, 29584696, 31976810, 34510808, 34548635, 35033156, 36443822, 37669935, 37789644	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28873435, 36423790	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	18571008		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	18571008		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951, 30026087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestatic liver disease	Cholestatic liver disease	BEFREE	17920062		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	LHGDN	15913806, 17989584		★☆☆☆☆ Found in Text Mining only
Chondrocalcinosis	Chondrocalcinosis	Pubtator	28377507	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12021923, 23088614		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	12021923, 18191107		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	23088614, 23415961, 29044189	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	23441172, 35974707	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31349076		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	36804377	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15596224, 1655396		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	12790768, 28804222, 29267209, 30109568	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31223316, 31275817		★☆☆☆☆ Found in Text Mining only
Chronic interstitial nephritis	Interstitial Nephritis	BEFREE	25298263		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11140698, 11786115, 15593053, 16046504, 17173255, 17198270, 24113078, 25871499, 25931475, 30371125, 9507209, 9931116		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15593053, 16046504, 22200425, 25158279, 25298263, 25385286, 26257513, 26337071, 27108839, 28042536, 28152529, 28339034, 28434671, 29026167, 29366406, 29518614, 29746568, 30138414, 30271345, 30371125, 31148248, 31505229		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	12944979, 22240154, 28611447		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12857600, 18492692		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	15726648, 17157157		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11371421, 14760152, 15175276, 15318814, 15916738, 16355005, 16456143, 16704031, 18550614, 19131638, 19186046, 19797132, 19838873, 19933216, 20193474, 20409024, 20683101, 21539942, 21556788, 21740629, 21908588, 22015454, 23267696, 23762390, 23886569, 24153451, 24358952, 24766819, 25015975, 27193053, 27323020, 27549738, 28284212, 28668545, 28784933, 29456676, 29472603, 30842769, 30970352, 31349846, 8202878, 9847291		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15175276, 18670143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	16365456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	11966931, 17209781, 23352795, 23688102, 25385297		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	15732863, 16824504, 17209781		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25040058	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31351582	Associate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28615628, 29367682, 30982052		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	16916603, 30161164, 30982052		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	10587400, 11700497, 19560950, 27329669, 29186866		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	36552777	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	28332779, 29134781		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10204502, 11345837, 15941661, 16842329, 18809335, 1900574, 20357999, 22682513, 24161121, 27268609, 27791279, 30392846, 31087761, 31550244		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	10469268, 16306446, 17947678, 18705752, 24142982, 26054450, 27870162, 30809271		★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	18357369, 29974846, 31772671		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	24589633, 34032749	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	26919310	Stimulate	★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	28802359		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	15731757, 17225872, 24589633, 26795696, 32524326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clubfoot	Clubfoot	Pubtator	35292718	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29423686		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	18355347		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	8697616		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27389178, 29505736, 30692517		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	17889927, 23950911	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	14707053, 15778431, 21830271, 24051933, 28815354, 29141406, 29441062, 29545894, 30315770		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	LHGDN	15778431		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	26589955, 27508510, 29922282	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	11742810, 15667502, 18186562, 21147109, 26589955, 31584460, 31918598, 32612071, 39252247	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23695510, 29794741	Stimulate	★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	9933455	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10416598, 10897042, 11029459, 11107064, 11147813, 11784716, 12438215, 12810668, 12893005, 1730743, 17985359, 18774639, 19844165, 21068203, 2288877, 2295065, 25813246, 29725419, 30621488, 31127990, 31825725, 7539800, 7549813, 7554087, 7743502, 7819128, 7961830, 7970729, 8082724, 8566583		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	27100181	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	10985498, 31081052, 7794080		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11771728, 18451140		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11784716, 12519076, 1698783, 17692120, 18281501, 18367323, 18774639, 20826792, 25417197, 27540973, 30066920, 30556866, 33570712, 36928437, 37845228, 38031087, 7539800, 7961830	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12174377, 14691305, 17214746, 17261758, 17394006, 17893910, 18281501, 18425817, 18778720, 19011936, 19036501, 19264229, 19724928, 19863607, 19863608, 19998449, 20012233, 20949628, 21479692, 22396040, 23084539, 23167402, 23208491, 23566254, 24402192, 24415879, 24441198, 24920174, 24935594, 25268580, 25884904, 26537064, 26779637, 26830472, 26873488, 27626488, 27840994, 27959430, 28300830, 28427243, 28601657, 28602978, 28693217, 29067459, 29388277, 29449642, 30071009, 30119180, 30119890, 30465755, 30515267, 30523755, 30648319, 30666129, 30668333, 30684462, 30979739, 31081052, 31242633, 31818187, 31825725, 7549813, 8566583, 8903488, 8978341, 9183654, 9207920, 9387902		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	24836286		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	24836286		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10077641, 10193412, 10389996, 10446110, 11309634, 11725828, 11771728, 11839715, 12046078, 12174377, 12237773, 12480928, 14616787, 15153332, 15754403, 16101328, 17214746, 17258738, 17890272, 18008360, 18219106, 18281501, 18422752, 18425817, 18651288, 18769113, 19169878, 19383344, 19574499, 19798702, 19898961, 20026115, 20164542, 20560206, 20565773, 20889724, 20949628, 21068203, 21365634, 21747928, 22278155, 22363134, 22761777, 23108401, 23442768, 23536895, 23614294, 23824282, 23974105, 24064667, 24166893, 24180698, 24204606, 24312311, 24375256, 24415879, 24427302, 24441198, 24628919, 24753543, 24935594, 25268580, 25330801, 25611389, 25617745, 25684678, 25755775, 25955104, 26056301, 26061281, 26482611, 26510091, 26537064, 26693911, 26714817, 26830472, 26852921, 26873488, 27008710, 27100181, 27177089, 27221051, 27543333, 27776350, 28183795, 28223538, 28300830, 28302086, 28348487, 28414818, 28418896, 28513830, 28620119, 28687755, 28717230, 28939678, 29465067, 29504907, 29599290, 29779016, 29789417, 29843204, 29976257, 29986644, 29986714, 30025541, 30050103, 30071009, 30154407, 30302922, 30355650, 30361904, 30363662, 30648319, 30728352, 30838002, 30854932, 30931081, 31027226, 31060539, 31127692, 31127990, 31186036, 31434255, 31524634, 31545230, 31678770, 31830379, 32141232, 32142663, 32319644, 32390702, 32493700, 32706067, 32866710, 32954649, 33114016, 33125346, 33148262, 33294886, 33570712, 33608451, 33660570, 34111531, 34247571, 34321176, 34440856, 34445187, 34497681, 34727230, 34975867, 35035608, 35137551, 35236827, 35283273, 35456495, 35505597, 35560224, 35619575, 35671267, 35680565, 35798776, 35842424, 35883447, 36010567, 36044847, 36193963, 36510899, 36551305, 36807490, 37426316, 37774061, 38062804, 39456247, 39523401, 39644618, 7890601, 8795578, 9482899	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10323406, 10601563, 22396040		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12046078, 12174377, 17261758, 17394006, 18219106, 18425817, 18651288, 19020727, 19036501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15187109, 24253505, 34096454, 36077264, 38019256	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15574495, 17214746, 34857888, 36700211, 36959211, 7794080	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	24836286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	24415879	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	19559392, 24619148		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	16586546, 20499382, 28061755, 28591041, 28700046, 29073595, 30058578		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	15593053		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	10235000		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30159734		★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	20100616	Associate	★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	22128246		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11274636, 21183289		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	24969562	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27364974, 29100373, 31121000, 31533404		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	21353594, 25603974, 28860542		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	26420484, 30321660		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	31028279		★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	BEFREE	26420484		★☆☆☆☆ Found in Text Mining only
Congenital muscular dystrophy (disorder)	Congenital muscular dystrophy	BEFREE	10063832, 16183658, 20655547		★☆☆☆☆ Found in Text Mining only
Congenital torticollis	Congenital Torticollis	BEFREE	30390390		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19625257, 25541130, 28624424, 28870505, 29175264, 29471264, 29487140, 29620209, 29800064, 29859189, 30016400, 30078811, 31072570, 31177814, 31223316, 31275817, 31317653, 31410120, 9493904		★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	29242028	Associate	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	20037209, 21503670		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	24380766, 25073432, 31784499, 34807419	Associate	★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	15358693	Associate	★☆☆☆☆ Found in Text Mining only
Conotruncal defect	Conotruncal defect	BEFREE	24443223		★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	31467177	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10232610, 12970754, 17032147, 18357369, 18709334, 19493342, 21150720, 21826227, 25909813, 26631499, 27806310, 28363829, 28881668, 29289594, 29568359, 29928489, 29974846, 30171816, 31729097, 31848806, 9166292		★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cor pulmonale	Cor pulmonale	HPO_DG			★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	LHGDN	18776948		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	20534926, 21462384, 21921985	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	14576527, 17768377, 19951597, 31756391		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	26553048	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy of Bowman layer type 1	Corneal dystrophy	Pubtator	12942051	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	22955109, 36320085	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14575520, 15381204, 16543493, 19005292, 22513132, 22607024, 25155040, 25592103, 26383248, 27234600, 27835972, 28731891, 29701163, 30317247, 8901839, 9831690		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	10475771, 21889313, 24533640, 25592103, 28584231, 28829817, 29332922, 30006123, 30307970, 30892430, 32223575, 32513244, 36538237, 40649979	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	15381204, 16543493, 19005292, 22607024, 23023190, 25155040, 25592103, 26383248, 27234600, 27835972, 28829817, 29701163, 30317247, 8901839, 9831690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714974, 28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	30317247	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Dissection Spontaneous	Spontaneous coronary artery dissection	Pubtator	33866193, 35583931	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26383248, 27997991, 35060248	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11786115, 15381204, 16543493, 19005292, 22607024, 22662243, 24443223, 25155040, 25592103, 26383248, 27234600, 27344599, 29250160, 29701163, 30317247, 30321660, 8901839, 9831690		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	1328302, 15531203, 19394554, 26930482, 29332922	Associate	★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	25111595, 29106960		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	14643002		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	19463161	Associate	★☆☆☆☆ Found in Text Mining only
Cranioectodermal dysplasia	Cranioectodermal Dysplasia	BEFREE	28332779, 29134781		★☆☆☆☆ Found in Text Mining only
CRANIOECTODERMAL DYSPLASIA 1	Cranioectodermal Dysplasia	BEFREE	28332779, 29134781		★☆☆☆☆ Found in Text Mining only
Craniofacial Abnormalities	Craniofacial abnormalities	Pubtator	34916229	Associate	★☆☆☆☆ Found in Text Mining only
CRANIOMETAPHYSEAL DYSPLASIA, AUTOSOMAL DOMINANT	Craniometaphyseal Dysplasia	BEFREE	10063832, 20655547		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	37854185	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	15731757, 28804222	Associate	★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	31365333		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11518734, 11742810, 12181198, 17047091, 17367219, 18452219, 18704594, 20848532, 22819866, 22971085, 24051933, 25740948, 26428636, 28088612, 28453765, 28670577, 28993955, 30122880, 8613031, 9119258		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	14678275, 15951536, 16327498, 17047091, 20489045, 21228771, 23232296, 24074435, 25578979, 26428636, 32031621, 32587447, 35841457, 9923802	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15667502, 20848532	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	25390077	Associate	★☆☆☆☆ Found in Text Mining only
Curling Ulcer	Gastric ulcer	CTD_human_DG	12868675		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	16634896		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29325547		★☆☆☆☆ Found in Text Mining only
Cutis Laxa Autosomal Dominant	Cutis laxa	Pubtator	21309044	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutis Laxa Autosomal Recessive Type I	Cutis laxa	Pubtator	20389311	Associate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	21189329	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	8959553		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	18292811, 18424453, 23950911, 24062613, 27684511, 35525938	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	25405607	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10596703, 10817792, 12000722, 16207846, 17158822, 18292812, 18424453, 19466271, 19738092, 21337732, 23950911, 24062613, 25134464, 25268501, 25803862, 26338706, 27234323, 29232160, 29239766, 30806029, 34887365, 35446787, 35525938, 37579743	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10817792, 11726399, 17052957, 17406643, 18292812, 18424453, 19009622, 19466271, 19738092, 20047061, 23671668, 24062613, 26277914, 26338706, 27870967, 29104653, 29877096, 31220469, 31590401		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	LHGDN	12000722, 16207846, 17052957		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic fibrosis	Pubtator	16127427, 17047099, 23671668, 39543807	Stimulate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	ORPHANET_DG	18424453		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic fibrosis	Cystic Fibrosis	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	GENOMICS_ENGLAND_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CYSTIC FIBROSIS MODIFIER 1	Cystic Fibrosis	BEFREE	17406643, 20047061		★☆☆☆☆ Found in Text Mining only
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	26930482		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10996011, 11966774, 16564576, 17187661, 17594488, 18780763, 19036616, 19264156, 19279017, 19890996, 19997821, 22242865, 22380539, 22682473, 23369825, 24006099, 24135912, 24635637, 25501632, 25529198, 26068512, 26188189, 26395178, 26521740, 26593049, 28542404, 28739110, 28814877, 28939526, 28944864, 29207646, 29621661, 29641281, 29898378, 30031224, 30117199, 30205161, 30450736, 30502449, 30581556, 30610922, 30664745, 30938133, 31074173, 31232696, 31409892, 31495059, 31591875, 31704612		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18398939, 18780763		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	30664745		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11282546, 16635548, 16904244, 31557051		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	16496359	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	16904244		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	10749696	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	21862019	Inhibit	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	16990569, 25835425		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	LHGDN	16990569		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	28103949, 28981455, 31779094, 36499320	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	28779848	Associate	★☆☆☆☆ Found in Text Mining only
Denys Drash Syndrome	Denys drash syndrome	Pubtator	10586431	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	10749696	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	21924590, 29131079, 29302075, 29438781		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	21924590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	27414954	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	26878989		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22427475, 25510765	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22968402, 23436698, 27448748, 38066678	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	12370399	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	27530865	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	11012755	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11496247, 22427475, 23301526, 23436698, 29310944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	12615364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	16634896		★☆☆☆☆ Found in Text Mining only
Dermatofibrosis lenticularis disseminata	Dermatofibrosis Lenticularis Disseminata	BEFREE	9636965		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15057277, 2071936, 21135506, 22253566, 2299195		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	10637094, 30764873, 9143260		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19364061	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24288551	Stimulate	★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	23035734	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	8380955	Associate	★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	15750822, 17785866		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	24705252, 34050248	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	28860542	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11309160, 11384198, 12481143, 17052957, 17173255, 19279557, 19553350, 19786738, 21478266, 24424289, 25592103, 26718502, 27840317, 28105508, 28220578, 28905939, 29227005, 29476359, 29705354, 29844093, 30338820, 30350412, 31198980, 31461798		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31099333, 33287755	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11309160, 11384198, 12481143, 17052957, 17173255, 17664181, 19193655, 19279557, 19539633, 19553350, 19786738, 21478266, 24306208, 24424289, 25592103, 26718502, 27840317, 28105508, 28220578, 28905939, 29227005, 29476359, 29705354, 29844093, 29972827, 30338820, 30350412, 30764873, 31198980, 31461798, 31773714, 31794697, 8691733		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	11309160	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	12213733, 15200451, 16879245, 19539633, 19744994, 21521871, 22623064, 23049541, 23106921, 23841104, 24441198, 24927876, 25086906, 25592103, 25674226, 26919310, 27411924, 29183809, 30338820, 33369638, 34296783, 35109843, 35841007, 37758806, 38139275, 39941136, 8691733	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	19175688, 24172699, 35217004, 35379202	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus autosomal dominant type II (disorder)	Diabetes Mellitus	BEFREE	21316027		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	20686866, 21900154, 23049541, 23494449, 23637351, 32346380, 35299968, 39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22332874, 32936764	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12675860, 17428349, 18676351, 20346437, 23399816, 25086906, 25401107, 25871499, 26064986, 29528020, 30338820, 32567428, 33538080, 33942489, 36209084, 39275851	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34079246	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37446346	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10714434, 12500218, 15606694, 17498265, 19120290, 19136037, 20039825, 20686866, 25931475, 26663878, 28695870, 29145717, 30136104, 30396876		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	12500218		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11992481, 12649573, 17130203, 17173255, 17622752, 21885147, 23399816, 23595247, 25871499, 26059110, 26064986, 28069811, 28352334, 28403088, 29259937, 30233664, 30338820, 30461200, 30826251, 31304816, 31469688, 31799723, 31841202		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12649573		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23500658		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	31049640		★☆☆☆☆ Found in Text Mining only
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	32936764	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	29138820		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	34926700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	LHGDN	12060054		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	27102877, 34474187	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	28459181		★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	11696451, 11879191, 12213733, 14633126, 17034027, 18293167, 18508967, 19858036, 20056746, 20460752, 20833210, 21991303, 22266139, 23399816, 23902294, 25871499, 26990852, 29207067, 29551286, 29587265, 30132841, 31173306, 31355294, 32289379, 32705273, 33795655, 33858824, 34707799, 35947673, 38537808, 8050182, 8691733, 8821830, 8952542, 9067916	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37752256, 37758806	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38139275	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10588367, 10744662, 11053476, 11576951, 12500218, 12631068, 15327405, 15918106, 16270194, 16394111, 17173255, 17300978, 17319955, 17531120, 17622752, 17664181, 18579703, 20039825, 20103708, 20460752, 20883286, 21725704, 21871016, 21910069, 22266139, 23165112, 23220173, 23399816, 23617393, 23656889, 23737551, 23827664, 23991195, 24060183, 24428217, 24887517, 25003613, 25046864, 25085843, 25871499, 26045739, 26414003, 27112839, 27340677, 27485077, 27874055, 28127848, 28352334, 28403088, 28411025, 28440482, 28566504, 28802633, 28839221, 28861164, 29033543, 29042993, 29207067, 29378192, 29551286, 29587265, 29684848, 29705354, 29725042, 29844093, 29909344, 30024615, 30125566, 30136104, 30271343, 30397232, 30425453, 30458730, 30847937, 30940309, 31105790, 31136992, 31155289, 31173306, 31258671, 31266808, 31356112, 31534017, 31534545, 31564202, 31572545, 31629762, 31704098, 31781203, 8691733, 8821830		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	12500218, 12675860, 15539010, 15957132, 16270194, 17319955, 18676351, 18842317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	18682491, 19960420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	16696316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	10435836, 17622752, 24710116, 26064986, 26617758, 30186476		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26064986, 26617758, 27564721, 29115286, 30595603, 33156339, 35734878	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	27496082	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	25333259		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20133617		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	17195236, 22803775		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	23496965	Associate	★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	30429487		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11703351, 8300749		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	11703351, 25478570, 29244857, 35060072	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	CTD_human_DG	22194977		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry eye syndrome	Pubtator	25817729	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	10793000, 24047375, 24210100, 31425971	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane Retraction Syndrome	BEFREE	14522910		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	19344999	Inhibit	★☆☆☆☆ Found in Text Mining only
Duchenne and Becker Muscular Dystrophy	Duchenne And Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	27344223	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	CTD_human_DG	12868675		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duodenal Ulcer	Duodenal Ulcer	BEFREE	16971953, 17376051		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duodenal Ulcer	Duodenal Ulcer	LHGDN	16971953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren Contracture	Dupuytren contracture	Pubtator	16563228, 20676061, 21612641, 37894778, 8320323	Associate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	BEFREE	21612641, 29857907		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	30927912	Stimulate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	8840279		★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium syndrome	Pubtator	32964955	Associate	★☆☆☆☆ Found in Text Mining only
Dysgnathia complex	Dysgnathia complex	Pubtator	32100971	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	35605178	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	30884781	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26027897	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28177698, 28987239		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	30517030		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	25384022		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	17653872, 25879409, 30875252		★☆☆☆☆ Found in Text Mining only
Ectopia Lentis	Ectopia lentis	Pubtator	31180551	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11496247, 22427475, 23301526, 23436698, 29310944, 29911097, 31058363		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	23884466	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27589056, 32357159	Associate	★☆☆☆☆ Found in Text Mining only
EHLERS-DANLOS SYNDROME, SPONDYLODYSPLASTIC TYPE, 1	Ehlers-Danlos Syndrome	BEFREE	2023219		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	17016646		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	12746043, 15705190, 18670143, 20233420, 23734748, 30335480, 31343404	Associate	★☆☆☆☆ Found in Text Mining only
Encapsulating Peritoneal Sclerosis	Encapsulating Peritoneal Sclerosis	CTD_human_DG	17199790		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24339874, 26867675	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	29483653		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	CTD_human_DG	29483653		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	11192323		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	9579831		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12019154, 1616874, 19424634, 19506550, 21613448, 21771027, 22116456, 23176363, 2334934, 26675296, 27171242, 28336232, 29951943, 9579831, 9935198		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16621788, 17150964, 19506550, 20712893, 21771027, 22640183, 27171242, 27527140, 27542208, 27626172, 28841682, 29781387, 29951943, 30510261, 30695033, 31040369, 32524577, 34424031, 37169340, 38225862	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	9579831	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29136085, 29300932, 31443713		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	15265761, 16759923, 19505996, 24796928, 25207642, 26577912, 26675296, 28397725, 28760197, 30843336, 31903498, 32348176, 32524577, 33723310, 36551177, 36768775, 37008951, 9806561	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	16144297, 17644809, 19249027, 19773286, 21623988, 24796928, 25207642, 26354330, 26577912, 26675296, 27130956, 27385728, 28184445, 28397725, 28760197, 28903471, 29391020, 29438550, 29669342, 30423016, 30523440, 30542051, 30826860, 31105783, 31443713, 31792175, 9239722		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16144297, 17644809		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21614520, 28300844	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	12181198		★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24732104	Inhibit	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	26670709, 32319640	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	12759459, 1726708		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	1726708	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia-Myalgia Syndrome	Eosinophilia	BEFREE	1702819		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	19796194, 21047675, 25539192, 26656423, 28832026, 29790577, 31636346		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	19796194, 24486052, 24835503, 26656423, 27212082, 28832026, 29029802, 31636346, 32352681, 32712105	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	1919049	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	22002724, 30693469, 32947957, 33333127, 35779740, 35779741	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	30684555, 37161592	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28576733, 29483653, 30386206		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	29483653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	29483653	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	22698689	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	29483653		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	18398367		★☆☆☆☆ Found in Text Mining only
Epispadias	Epispadias	BEFREE	28888749		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21614520, 29017822, 29048644, 29537103, 29751820, 30158641, 30485902, 30814239		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	17689884		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	LHGDN	17689884		★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	24075003	Stimulate	★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	30333254	Associate	★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	28811677		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	22935165		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11910473, 19083192, 19212830, 20563251, 24684802, 25544767, 26096658, 31371781		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11910473, 19083192, 19212830, 20563251, 24684802, 26096658, 31371781		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15102678, 18426913		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18426913, 19360286, 20056838, 20300551, 22393371, 24684802, 24756761, 25554686, 30880778, 34725559, 35870178	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10789724, 12209716, 15736400, 18439605, 24798237, 25464508, 25897987, 27036032, 27987372, 29379981, 30280774, 30880778, 32769441, 33760133, 34016746, 34218518, 34799871, 35311444, 36008860, 36056599	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25064463	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	30392846		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	19796194, 23334061, 26656423, 29953975	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	23334061		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15049387, 20459371, 22209986, 24687999, 25856002, 26335431		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	16609677, 19922630, 20356380, 20459371, 24687999, 29201909	Associate	★☆☆☆☆ Found in Text Mining only
Evans syndrome	Evans Syndrome	BEFREE	30784322		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	18097622, 28030800		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29401156		★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	28114575		★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye Neoplasms	BEFREE	11113869		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	31718986, 31778662		★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Factor VII Deficiency	Factor vii deficiency	Pubtator	29326176	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	18063474		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18619832, 21876965		★☆☆☆☆ Found in Text Mining only
Familial primary pulmonary hypertension	Pulmonary Hypertension	BEFREE	22227206		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	22474227, 33478117, 35427808	Associate	★☆☆☆☆ Found in Text Mining only
Familial pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18496036		★☆☆☆☆ Found in Text Mining only
Familial vesicoureteral reflux	Vesicoureteral Reflux	BEFREE	17707032		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	29247345, 30515693		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	33570643, 35605178, 37021532	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	29247345, 30515693		★☆☆☆☆ Found in Text Mining only
Fasciitis	Fasciitis	BEFREE	1702819		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	15280416	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	22118314, 29202780	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	14642613		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	16344856, 19401628, 31243135, 32498337	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	1900574, 28811292, 30581002		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31087761	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32330605, 33992698	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	17032406, 21664615, 22108052, 30579258, 30720468, 30737662, 31087761		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	11925630		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	26076859		★☆☆☆☆ Found in Text Mining only
Fibrocystic Disease of Pancreas	Cystic fibrosis of pancreas	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	10566662, 11158066, 12548199, 12629129, 16571622		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	12548199, 15604209, 16571622		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	LHGDN	17145161, 17601559		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	9736407		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	1281156, 16547158, 2046332, 29355494		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29705706		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	10204502, 11750277, 12000722, 12974899, 1380023, 14606082, 14642613, 15137003, 15800982, 16496318, 17032406, 17526009, 17911416, 20212457, 20956977, 21790536, 22171141, 22271822, 23941979, 24100264, 24242045, 24496160, 24530597, 25013893, 25111595, 25148875, 25345787, 26097586, 26559755, 26592197, 26909983, 27279449, 27633729, 27979710, 27983763, 27991776, 28012025, 28025657, 28086769, 28151059, 28181132, 28193525, 28245465, 28262670, 28301738, 28390311, 28527877, 28544244, 28552397, 28602220, 28611447, 28623179, 28625011, 28647476, 28665955, 28739486, 28823370, 28826091, 28837849, 28839277, 28849131, 28864168, 28918026, 28919164, 28936800, 29047177, 29073595, 29106960, 29196956, 29207068, 29243785, 29258603, 29286088, 29311932, 29322934, 29375381, 29402841, 29490978, 29538616, 29636890, 29656250, 29864192, 29891777, 29934723, 29957876, 30036520, 30074181, 30098497, 30106235, 30109568, 30226813, 30231008, 30243650, 30249543, 30315255, 30350999, 30365941, 30543783, 30556540, 30568253, 30584275, 30632134, 30644744, 30660615, 30675748, 30723271, 30906211, 30935693, 31079002, 31121384, 31124340, 31258636, 31285763, 31362006, 31377585, 31412137, 31435175, 31468266, 31508820, 31522982, 31550244, 31677501, 31717385, 31730938, 31737983, 31755616, 31758498, 31797693, 31802713, 31835194, 31839486, 7843697		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	21037076		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	32785072	Associate	★☆☆☆☆ Found in Text Mining only
Focal Emphysema	Emphysema	CTD_human_DG	12634787		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	11786088, 14531804, 15308875, 20185928, 21378152, 9100161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	16191423, 18682491, 20493835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Folic Acid Deficiency	Folic Acid Deficiency	LHGDN	16111879		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29061379		★☆☆☆☆ Found in Text Mining only
Freeman-Sheldon syndrome	Freeman-Sheldon Syndrome	BEFREE	30530236		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	31081340		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	26302187, 28754918, 31469403	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	18571008, 23665284, 24310606, 28611292, 30614799		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	12579267, 18571008		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24310606	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	28060377, 28611292, 32406793	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30854698		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	17376051		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	14988821, 18665940, 23030255, 24121150, 24462401		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27196487, 31320834	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	32947843	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	34104107, 35905420	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	31369967	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	23884466	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	24129565, 29391140		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	14669355		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	15574495, 30268436	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	21390241	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	36498937	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	21683322	Associate	★☆☆☆☆ Found in Text Mining only
Geleophysic dysplasia	Geleophysic Dysplasia	CTD_human_DG	18677313		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	31005663		★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	19755996	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21205231, 22722999		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	40084998	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	16634896		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	1756472, 38214358, 7977641, 8500096	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	23690270		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	15972593, 18385522		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	34234776	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	15895394		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	15895394, 20945401, 21546528, 26396484, 27229292, 28400560, 29509235, 33746571, 33832461, 34156425, 34940783, 35142784, 36835591	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	25811482	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27300643, 28088523, 30542465		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	25811482	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	33832461	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	19145252, 23940598, 26820987, 29752408, 35461232, 35689009, 36180030	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25811482, 34870675	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	17570736, 21348595		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10048979, 10744032, 10783396, 11810184, 17469181, 17621264, 18711401, 1874566, 19192267, 2222434, 23132729, 25326894, 25849941, 26717894, 27049916, 27212030, 27621042, 2809198, 28393230, 28393237, 28617438, 28763794, 28783169, 28834297, 29467947, 29872504, 30226551, 30243878, 30353492, 30850588, 30867843, 31160907, 31282108, 31401659, 3262361, 9049853, 9525812		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10783396, 11390472, 17469181, 18829576, 19192267, 19574499, 20419098, 23249750, 23776187, 24517116, 25165192, 25256711, 25315188, 25813152, 25832460, 25849941, 26090865, 27270107, 27354342, 28381482, 28481241, 28526854, 28735518, 28834297, 29158223, 29238047, 30353492, 30952620, 31282108, 31432189, 31649250, 31791385, 32813021, 33025417, 3322813, 33471197, 33568520, 33964937, 34884812, 35163067, 35203105, 35418179, 36272241, 36292985, 9577364	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29642484, 33494271	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30226551, 31784984	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10048979, 10744032, 10783396, 17621264, 18711401, 19192267, 2222434, 23132729, 25315188, 25326894, 26717894, 27049916, 27212030, 27621042, 2809198, 28393230, 28393237, 28617438, 28763794, 28783169, 28834297, 29467947, 29872504, 30226551, 30243878, 30353492, 30850588, 30867843, 31160907, 31269723, 31282108, 31401659, 31427735, 3262361		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10048979, 10448868, 10679251, 15492287, 16292494, 17292826, 1874566, 19192267, 19235591, 21359495, 22544614, 25813152, 26317904, 26976322, 27212030, 27574009, 28817313, 31186801, 31507151, 31729763, 31788066, 9488308		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11390472, 15584904, 17292826, 17414317, 17440061, 19192267, 19431147, 20150362, 20511186, 21359495, 21775821, 22104964, 22752645, 25165192, 25529192, 27287871, 27574009, 27978994, 28484053, 29238047, 30320350, 31906574, 33471197, 33494271, 33917452, 35418179, 35720326, 36124685, 36153326, 36255058, 36284444, 36635261, 37081231, 37901992, 38256406, 40702072, 7477684, 8869149, 9577364	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16292494, 17292826, 19235591		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26317904	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29517201, 8054266, 8200640	Inhibit	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	37169340	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	10504488, 12009422, 12911160, 14531804, 14745123, 15462102, 15906952, 16586546, 16612332, 19693466, 19726546, 22119820, 22879939, 25026939, 28815607, 7996808, 8050182, 8264131, 8995728	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	16086153, 16586546, 17173255, 17205957, 25835392, 28356164, 9100161		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	17205957, 18216320		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	11359449, 15906952, 18421480, 18496506, 19258388, 19693466, 19946746, 21494642, 24023680, 25523477, 27044423, 31728204, 8301931	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28273242, 36648741, 8821830	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	10620196, 12969126, 35172688	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	11560950, 12466133, 12500218, 12651625, 14531804, 15199407, 15372454, 15942255, 17494887, 20650904, 21378152, 25158279, 27826032, 28214865, 28419296, 28479222, 28719898, 31358596, 31377057, 31545275, 9100161, 9375822		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	11786088, 14531804, 9150474	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	26322947	Stimulate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	28046097, 29654633	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	31365430		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	11168939, 15086490, 19158077, 25587706, 29551286, 30383875	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	37758806	Stimulate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	18356176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	36550178	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	36850003	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11835352, 17378698, 18344931, 19392797, 19713222, 20190732, 20457266, 20548127, 21629186, 32818226	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	20446793	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	17429441, 21629186, 26544732, 31149046, 31527815		★☆☆☆☆ Found in Text Mining only
Granular Dystrophy, Corneal	Corneal Granular Dystrophy	BEFREE	14576527, 29943099		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	11715070, 8697616		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	8697616	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	18774655, 29788434		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	18190611, 20926009, 24742542, 26406959, 27345036, 29266775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	18190611, 27345036, 29266775, 29739987	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	20926009, 27340508	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	2921318	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32176314, 33597925, 34202024, 34680057, 35563653, 37272763	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	16723698	Inhibit	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	26675296, 34916229	Associate	★☆☆☆☆ Found in Text Mining only
Growth mental deficiency syndrome of Myhre	Myhre syndrome	Pubtator	24398790, 33428109	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31479869		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	LHGDN	14991065		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	22002724		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	25111595, 29106960		★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	18525195		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	18190611, 20191437, 25422352, 26218277, 30070177		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	18190611, 25412700, 33125100	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	18375250		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	35871446	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15170816, 28049456, 29163637		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	16478646, 28945296, 38200037	Associate	★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	LHGDN	12960355		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	15731757, 26044615	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	10733758, 15358693, 22513132, 23884466, 27098600, 29462303, 30739867, 30971721, 32443848, 35328443, 35427808, 37298503, 37930292	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22513132, 25789971, 27098600		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23342164, 26338706, 40095970	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	15200451, 25298166, 30272299, 31124999, 31223316, 33016206, 35672400, 36204659, 38256034	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	16095497		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19625257, 25541130, 28624424, 28870505, 29175264, 29471264, 29487140, 29620209, 29800064, 29859189, 30016400, 30078811, 31072570, 31177814, 31317653, 9493904		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31072570	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	BEFREE	31466059		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Congenital heart septal defect	Pubtator	15358693	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	12466127, 23465222		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	28377507, 35315241	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	30146616, 9736807, 9915157		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	23599148	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	18024394	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16865698, 28642593		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24256874	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	31211692, 37121717, 37925591	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	18024394		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	35474271	Associate	★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	32968152	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	10188109	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	26928604		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	11298593	Associate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	33062074	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	11426486		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	25930091, 29993342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhage	Hemorrhage	Pubtator	23468366	Associate	★☆☆☆☆ Found in Text Mining only
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	29242028	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30940161, 31734229		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	36293192	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Fibrosis, Congenital	Congenital Hepatic Fibrosis	BEFREE	10204502		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25716231	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26648552, 33506937, 35022275	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	16586546, 23395388, 34168644	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25716231	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	11242803, 16627984, 21384510, 24496160, 25966218, 27123854, 29061957, 31243135, 34360721, 35022275, 36215278	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15800982, 16425360, 17600343, 18092051, 24496160, 32962821, 35469194, 36466817	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	17006932	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	20926009		★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	30193922		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11267935	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19574499, 19937272, 21890597, 24146803, 28678584, 30027292, 34911484	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	10697802, 11334464, 11811509, 12710748, 16677327, 19422573, 19886734, 29292365, 29325232, 29989318		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	15941661, 9303489		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	15907823		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	24415879		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	30828872		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	35469194	Associate	★☆☆☆☆ Found in Text Mining only
Heterotaxy Syndrome	Heterotaxy syndrome	Pubtator	26111189	Associate	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	30140888		★☆☆☆☆ Found in Text Mining only
High grade surface osteosarcoma	High Grade Surface Osteosarcoma	BEFREE	9771482		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	23527089	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	14704634, 15200451, 17644739, 7681031, 8424449		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1632458, 17720884, 22167753, 2904450, 29315015, 7745117	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17644739	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15200451, 20082658		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22748967, 26056083, 26651603, 33049985	Associate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Segmental Glomerular	Glomerular Hyalinosis	CTD_human_DG	16191423, 18682491, 20493835		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	10584844, 27769788, 28926478		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	LHGDN	14614718		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	22901921		★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	29898959		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	19625761		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	2891388	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalciuria Absorptive 2	Hypercalciuria	Pubtator	18480302	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28420668, 28926478		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	36927534	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	15662225		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	1726708, 26112417, 34459778	Associate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	31770396		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	31770396	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11053476, 12107734, 19193655, 19450275, 20145925, 21478477, 21733321, 23430124, 24306208, 25085843, 28747378, 28987239, 29331653, 29462799, 29930382, 30314265, 30420805, 31415598, 8691733		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	12107734		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25086906, 31625803	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	8691733	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	16896935, 31377002		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	34296783	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	15840021	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	15662225		★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	28387228		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	34601016	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	31505229		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	12911563, 24716596, 26428636	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperplasia	Hyperplasia	Pubtator	1908092, 20954112, 21781173, 30984775	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperprolactinemia	Hyperprolactinemia	BEFREE	28096433		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	16889541	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	7615854	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	39201708	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	9061041	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	10725360, 16482098, 26502942, 39595551	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	12675860, 14531781, 18293167, 18821144, 19330901, 19768163, 25856002, 26064986, 26198819, 28827564, 31147455, 32354559, 33652665	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	11015450, 12225948, 16227320, 17336165, 21625455, 31141166, 31703702, 37731513	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Resistant to Conventional Therapy	Resistant hypertension	Pubtator	39971624	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	31840157		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10725360, 11740395, 12032592, 12219869, 12225948, 12481143, 18821144, 19106168, 20511416, 22005303, 22209986, 22813949, 23337395, 24091331, 24413999, 25155040, 26064986, 26198819, 27297622, 28438687, 28447711, 28575138, 28791353, 29863758, 29976656, 30430898, 30783440, 30784906, 31115027, 31254954, 8901839, 9931116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	11682445, 19018797		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12032592, 18097622, 18256755, 18496036, 18821144		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	20926009		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	29131274	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11113012, 9264495		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	11782760, 9264495		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	12531888, 17369289, 22879939, 31409892, 35406794, 37652257	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	17428349, 24782191, 24823657, 26428636, 27569062, 28951244, 32790806, 39653186	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	15049387, 18821144	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	15200452, 36850003	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	15941661		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	BEFREE	15529502, 25501212		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	23871585	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	30380353, 31726466		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	18190611		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	18190611	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11115069, 12225948, 16014625, 19187226, 22705563, 22974282, 23067574, 23690936, 24180698, 26800359, 31422771, 34197482, 34367731, 34601016, 35457151, 36265878	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	1373333, 15220111, 18050204, 19036873, 21209004, 21680037, 23723999, 23786654, 23871585, 25851169, 27124111, 27622654, 27909731, 28397725, 29699590, 31339433, 31925944, 32968152, 33389556, 34200497, 34887659, 36012235, 36672223, 37246768	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19951945	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	9603194		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29896199		★☆☆☆☆ Found in Text Mining only
Idiopathic hypercalciuria	Hypercalciuria	BEFREE	25394514		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	10620196		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11502704, 18097622, 18792970, 23418342, 27297622, 28467929, 28619995, 28924387, 30274147, 31023188, 31734320		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10188109, 16948840, 18795102, 20212457, 20483575, 20685750, 22014187, 23031257, 23043088, 23223528, 23755232, 23815594, 24376648, 24515257, 24790080, 25199049, 26538547, 26709222, 27107963, 27310652, 27815256, 27836973, 28081703, 28314802, 28783377, 29074489, 29144435, 29348469, 29616048, 30155985, 30335500, 30709904, 30984775, 30988425, 31511015, 31660581, 31925944, 31941499, 32159970, 32258117, 32668192, 32887938, 33149556, 33474654, 35098542, 35594338, 35901086, 36211385, 37626894, 37798725, 38225283, 39745695	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11306432, 12635140, 12746254, 15863652, 16908447, 16948840, 1862087, 19117745, 19393328, 19850962, 20212457, 20685750, 21420029, 21882188, 22088447, 22117501, 22284809, 23031257, 23043088, 23344525, 23492187, 23755232, 23815594, 23924348, 24276150, 24307592, 24376648, 24515257, 24756243, 24890164, 24958208, 25015975, 25260753, 26276873, 26386411, 26538547, 26600197, 26709222, 26861876, 26867691, 26934369, 28191779, 28254114, 28257580, 28389561, 28771711, 28783377, 28821451, 28865842, 28977842, 29074489, 29144435, 29273797, 29386344, 29516782, 29774214, 30096654, 30232270, 30233503, 30443024, 30524284, 30988156, 31012597, 31387171, 31511015, 31606345, 31629729, 31656675, 31786325, 9512902		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11713352, 12882453, 22295148, 28128990, 28178340, 29321510, 38117249	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18395486		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	11502704, 18097622		★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	27044423	Stimulate	★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	8544410	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	11728950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	15191521, 15593052, 15730046, 15925904, 18264937, 18300111, 19258388, 20479942, 20650904, 23420368, 24271554, 24286426, 24564406, 25112155, 28208683, 28273242, 28946966, 31600491, 8301931, 9044311, 9100161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	15191521, 16792132, 18264937, 18300111, 18334740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune system disease	Pubtator	10354153, 22107611, 28314381, 30320351	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17892594, 18321307		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37096442	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	10477725, 14608199, 14687032, 21591983, 24801815, 28142109		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	8301144		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11719464, 1700428, 26986868, 29749506		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26402106, 27389178, 29505736, 30692517		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	10637094		★☆☆☆☆ Found in Text Mining only
Infantile inflammatory bowel disease with neurological involvement	Inflammatory Bowel Disease With Neurological Involvement	Orphanet			★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	37108732	Inhibit	★☆☆☆☆ Found in Text Mining only
INFLAMMATORY BOWEL DISEASE, IMMUNODEFICIENCY, AND ENCEPHALOPATHY	Inflammatory Bowel Disease	UNIPROT_DG	29483653		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
INFLAMMATORY BOWEL DISEASE, IMMUNODEFICIENCY, AND ENCEPHALOPATHY	Inflammatory Bowel Disease	CLINVAR_DG	29483653		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11454793, 14600158, 17047091, 22140658, 22584294, 23287011, 23492772, 24432317, 28088612, 28993955, 29483653, 29545894, 29973939, 30147698, 31718200, 31784682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11518734, 11742810, 15667502, 20944558, 22584294, 23492772, 26660358, 27508510, 27782111, 29420705, 29483653, 29922282, 32390702, 32612071, 34561227, 35426367, 35905575, 36140740, 36775873	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27468194	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	29483653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory dermatosis	Dermatitis	BEFREE	22253566, 26878989		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19401628, 19763090, 27903298, 30461200, 38166771	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	LHGDN	18058603		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	15731757	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	15340826, 23479156, 28358123, 28935976, 29636026, 31808511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	15340826, 15980999, 25372418, 27075568, 29636026, 31432173, 32873329, 35840955, 37784117	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	CTD_human_DG	21351055		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral disc disease	Intervertebral disc disease	Pubtator	24551286, 34122424	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	15980999, 28260009, 34122424	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15951536, 33803197, 36615756	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	21830271		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22294131	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal obstruction	Pubtator	9923802	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	15731757, 26198819, 30742604, 36451838	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	26198819, 30742604, 30867687		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	22643235, 32560555, 36198763	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhage Traumatic	Intracranial hemorrhage	Pubtator	33955515	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	16024014		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	17072955, 29569474, 29584696, 30182496		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	11345133, 16807982, 21470928, 29568948		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31171361, 9303489		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	35672400	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	15951536, 21803306, 29698332, 33441166	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	21803306, 22897390, 29698332		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	9264495		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	16990569, 23861796, 28110342, 29704604, 31478148, 9056612		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	29201188		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29494710		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	12476040		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	16816927		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	29869292		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	29287776		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	22575726, 26430764		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	24147544	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25247416, 26015770, 28145428, 29860458, 34478492, 36051483, 37108600, 37714423	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15920698		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	25394514		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	10586431, 10594789, 10725360, 11073823, 11879191, 12009422, 12217862, 12787405, 12911160, 14531781, 14761892, 16598193, 17003485, 17361117, 18293167, 18421480, 19768163, 20093492, 20720360, 22215279, 22859744, 23576639, 24040439, 24798563, 25523477, 26064986, 26508723, 26974954, 27155083, 27853248, 28060893, 28339906, 30539648, 33069430, 34736391, 35253468, 37108249, 37707956, 38081679, 8050182, 8731094, 8821830, 9150474, 9507205	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	11682445, 14675041, 18390891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	11740395, 12466133, 15372454, 15606694, 15769863, 15788474, 16046504, 16176689, 17130203, 17173255, 17389734, 17656471, 18216320, 19110334, 19279557, 19465643, 20039825, 21303424, 21927575, 22190171, 22366990, 24113078, 25158279, 26064986, 28565830, 28719898, 29193729, 29380373, 29434785, 29518614, 30383875, 30539648, 30618784, 30976056, 31301369, 31480595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	11849412, 16612332, 36292960, 37752256	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	11008076, 11140698, 11786115, 11803605, 12572925, 17173255, 22813949, 24113078, 25724035, 25931475, 29746568, 9507209		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10725360, 14531781, 19768163, 31929749, 40751815, 9507209	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	11786088, 11786115, 15086490, 25871499, 31464346, 37439962	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	10469268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	18496552, 28848189, 31318905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	11140698, 11786115, 15593053, 17173255, 17198270, 21832251, 24113078, 25871499, 25931475, 28765904, 30371125, 30618784, 9507209, 9931116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	15593053, 15942255, 17198270		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19420110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	10594789	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11073823, 11555647, 26848077, 31449970, 35179216, 38148073	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	29434931		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	32362625	Associate	★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	23071866	Associate	★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	28180980		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11113012, 19728040, 30552887		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15374708, 18248652, 19700613, 19906824, 25596622, 25713613, 30871768, 33036796, 35032343, 36313223, 36771423	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	15716079, 8112853	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	11122237, 12641657, 22429842, 30540075, 35703715, 37153623, 9737674	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	30540075		★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	11122237, 12641657	Stimulate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	24454972	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10907639, 1737088, 19406989, 2070083, 2358774, 24304929, 2460153, 7521696, 7780149, 9531610	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21740305, 24908319, 28601924, 29130994, 30997931, 8981938		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36959211, 7535588	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10210318, 7521696	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1512249	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21606166, 23179394, 28454099, 29773599, 31373163, 31600200, 3291977, 33073700, 33253299, 33539590, 40184725, 7685204	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	2891388, 33083479	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37233879	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	1737088, 21345218	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12163055		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24162813, 27486989, 29140182, 29307605, 29773599, 30997931, 31212277, 31600200, 8542949		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	2358774, 25358858, 9209305		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	29599317		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	26990749		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	26990749		★☆☆☆☆ Found in Text Mining only
Linear Scleroderma	Linear Scleroderma	BEFREE	30367460		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11276004, 18234959, 21865076, 23442056, 25744234		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	22926483	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	30824765	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10219856, 10362128, 10402064, 10534343, 10891333, 10913370, 11115538, 11242803, 11906173, 12669309, 12858019, 14769885, 15205326, 15763337, 16285938, 16474852, 16475024, 1649698, 1703520, 1712727, 18318443, 18522884, 18809335, 18949401, 18983820, 19169878, 19206163, 19329856, 19426152, 19793165, 20038433, 20602797, 21499307, 22290546, 22563190, 22682513, 22724518, 23151305, 23464434, 23653379, 23696034, 23787902, 24016252, 24186850, 24260309, 24809782, 24960176, 25087096, 25162823, 25261367, 25526895, 25560488, 25683165, 25818166, 25820415, 25966218, 26003220, 26419593, 26551914, 26799063, 26799667, 27041581, 27259324, 27268609, 27301206, 27302923, 27580057, 27581744, 27596296, 27720259, 27835897, 27872089, 28004118, 28025149, 28076850, 28110870, 28134289, 28202512, 28230858, 28245423, 28315912, 28415739, 28454396, 28492136, 28588321, 28624577, 28670383, 29100373, 29268242, 29312546, 29365054, 29431199, 29490293, 29524413, 29599317, 29690860, 29692627, 29797561, 29799303, 29882900, 29930716, 30070319, 30116333, 30121623, 30132576, 30134011, 30154409, 30193922, 30205014, 30232222, 30411378, 30447345, 30486878, 30536311, 30564064, 30597907, 30643426, 30698830, 30723271, 30876428, 30963691, 30973698, 31088527, 31186778, 31196853, 31197076, 31295152, 31402791, 31499614, 31562907, 7882305, 8174105, 8389483, 8649852, 9408971		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12669309, 12700666, 15763337, 15777850, 16285938, 18354237, 18506891, 18809335		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	9029167		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10204502, 11345837, 15941661, 16842329, 18547814, 18809335, 1900574, 20212457, 20357999, 22446332, 22611323, 22682513, 24161121, 27268609, 27610008, 27791279, 28061755, 28918026, 29275189, 30308196, 30392846, 31087761, 31087779, 31550244, 31643031, 31770396, 9930873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	LHGDN	11750277, 14635011, 17596875, 18381592, 18797412, 18809335		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	12000722, 14606082, 15349911, 15800982, 17477814, 1900574, 19506550, 19794996, 19878580, 20212457, 20230822, 20357999, 20531292, 21303922, 21384510, 21494076, 24250248, 24448807, 24496160, 24816397, 25030555, 25178323, 25502482, 26909983, 27273381, 27585228, 28262670, 29515105, 29633755, 30097701, 31187872, 31770396, 33923467, 33977112, 34168644, 34711009, 35138513, 35715541, 36443822, 36482069, 38068980, 38243118, 40649803	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	21037076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	21606534, 26097586, 31166951, 33682288	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	11925630	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	21494076	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11966774, 17158635, 25896390, 33977112	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	38228248	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	23274713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	18059363, 18092051, 1900574, 20212457, 21384510, 24905921, 33682288, 35138513, 35427808, 35485686, 36466817, 37962490, 38068980, 8567993	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	24669910	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	11925630, 38146363	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	20230822, 21424084, 25716231, 26909983, 29690860, 30926424, 34686321, 35051234, 36482069, 9622588	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26097586, 35022275	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28061755, 30940161		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	8567993	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30940161		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10534343, 11280770, 12669309, 1712727, 19169878, 19793165, 22563190, 26003220, 26987776, 27301206, 29312546, 7882305, 8174105, 8389483, 8649852, 9697699		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	15294900		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	19169878, 20380719, 37053209	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26301107	Stimulate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	LHGDN	16675963		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	2023219		★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	BEFREE	16550171, 25113270		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	11472967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	11970906, 12635140, 17053491, 17785866, 18424453, 19009622, 19349911, 19466271, 21044893, 22697347, 24062613, 28910321, 29427413, 29669483, 30321056, 31606345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	12905481, 16207846, 16365456, 16908447, 18563170, 19036873, 19466271, 19812599, 21039988, 21337732, 21625455, 22659883, 23950911, 24062613, 24498427, 26276873, 29382921, 30806029, 31268360, 32712053, 33589523, 35382780, 35525938, 36142862, 36257596, 37579743, 38245723	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	18292811		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	27905298	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	38158808	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	21241464, 24574232, 39560968	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	22924849	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	21484765, 22009278, 28932540, 30764873		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10748131, 10757810, 10945495, 1655420, 17600311, 17676583, 19047146, 19234174, 21360479, 21625455, 22045191, 22393947, 22571197, 22752005, 23094028, 23223528, 23437179, 23840350, 24072492, 24098479, 24615099, 24819169, 24913443, 25027596, 25107280, 25157127, 25482449, 25501935, 25542019, 25963361, 26152517, 26297431, 26450531, 26581907, 26921343, 27015122, 27432190, 27499032, 27566553, 27852821, 27974707, 28446126, 28739734, 28767724, 28804523, 28898237, 28918673, 29118814, 29934580, 29985912, 30256540, 30391585, 31344049, 31492158, 31591389, 31764844, 31811131, 32012400, 32092827, 32252552, 32603557, 3276718, 33207077, 33376719, 33589523, 33779563, 34253166, 34390443, 34912481, 35373505, 35449849, 35858707, 35998480, 36183833, 38087979, 38158808, 39189615	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11074608, 11641043, 17418594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	15033015, 17654453, 18834524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15187109, 25919050, 26187636, 28266181, 36097589	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	21508374, 22045191, 30940659, 31088909, 31764821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15199407, 30972208		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	30130620	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15457456, 17364494, 1747946, 17579298, 19020994, 19173720, 19841178, 20334681, 21708033, 22389764, 22621248, 22966240, 23401079, 23790231, 32602296, 32718891, 33274247, 33686190, 34519592, 36107445, 37108249	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16221206, 24062776, 26322947, 33198645	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18052965	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15199407, 26972571, 30130620, 30972208		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12630751, 15199407, 15221033, 16193177, 17364494, 18052965, 18473105, 19020994, 19173720, 21503670, 28234629, 29578533, 29684755, 30551949, 30886422, 30972208, 31771364		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15221033, 16646981, 18473105		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	11786088, 15221033, 25724035, 28216896, 30145800, 30209639, 30972208, 31356397, 9100161		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	15457456, 8050182	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	8821830	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15199407, 30972208		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12046078, 14669355, 16807982, 20506050, 22278155, 2331446, 25113249, 25993985, 30485902, 33271824, 8393616	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	12941820, 28703907, 29218244, 30485902		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15754403, 23918305, 24418088, 25338997, 26597083, 26848077, 33229445, 37971439	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17692120	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	28875388		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11385614, 1713611, 17643425, 19766114, 20551174, 22297256, 9169090		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	1312308, 20207982, 2066357, 26464657, 2898211	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	2789474	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15695537, 33881493	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24162786	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17644739		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	16524740		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	14704634		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16524740		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16524740		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24908319, 25681335		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	16889541	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	17700165		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	24415879		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29795291, 31700227	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30642396, 33510953, 35186229, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	9059252	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy retinal 1 North Carolina type	Macular dystrophy	Pubtator	26305530	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20452036, 28122130		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10448868, 11132930, 15492287, 17336898, 1874566		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15170816, 28049456, 29163637		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10470853, 10482694, 10521925, 10839458, 11401606, 11473365, 12386814, 12569017, 14607332, 14871809, 15006917, 15056732, 15082097, 15305380, 15803361, 15833881, 15878096, 15941974, 15949894, 16457687, 16959612, 17018785, 17032147, 17035001, 17293864, 17668048, 17721995, 17848193, 17965799, 18161870, 18299279, 18348656, 18434084, 18523885, 18676771, 18827819, 18932017, 19079339, 19092773, 19582787, 20096948, 20143152, 20154716, 20157775, 2021547, 20232138, 20309626, 20349130, 20349216, 20361250, 20506050, 20545612, 20576088, 20640597, 20845106, 21099351, 21829601, 22079734, 22100658, 22248507, 22436421, 22647687, 2295070, 23001908, 23054396, 23067574, 23129177, 23516540, 23887657, 23982878, 23996684, 24036252, 24036662, 24121667, 24146803, 24164868, 24425107, 24457988, 24618085, 24740564, 25109336, 25374198, 25531323, 25572132, 25813152, 25961925, 26138318, 26232605, 26419593, 26431436, 26482896, 26520789, 26716641, 26718214, 26896736, 27036297, 27178816, 27519288, 27751807, 27863394, 27867016, 28042775, 28078601, 28159748, 28263968, 28288400, 28407692, 28418877, 28542577, 28599447, 28722137, 28734865, 28892081, 28902348, 28993429, 29050223, 29113242, 29151919, 29187452, 29328467, 29362917, 29414799, 29557524, 29658391, 29717397, 29796175, 29809196, 30004628, 30012949, 30027292, 30128014, 30252131, 30275854, 30340644, 30570851, 30848576, 30901941, 31082421, 31142059, 31178227, 31247718, 31313132, 31405342, 31464639, 31470867, 8390290, 8669837, 9148862		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	1616874, 19424634, 19506550, 21771027, 22116456, 23176363, 27171242, 28336232, 29951943		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11910473, 19083192, 19212830, 20563251, 24684802, 26096658, 30693787, 31371781		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18571008, 28611292		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23998914		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	12686863, 1404666, 29079415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18809335, 22724518, 26345741, 26462837, 29100373, 29692627, 30232222, 31186778, 31740785		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11074608, 11641043, 17418594		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11195465, 11506965, 15823505, 16499994, 16875935, 17654453, 18759245, 19169878, 19349911, 21360479, 22393947, 22946048, 23022171, 23127773, 23137649, 23146760, 23223528, 23290789, 23545945, 23802127, 23840350, 24098479, 24121493, 24134845, 24140887, 24573038, 24642488, 25409890, 25433501, 26212008, 26297431, 26514616, 27178816, 27470220, 27543359, 28028969, 28075456, 28266181, 28412214, 28446126, 28472762, 28610976, 28629532, 28693227, 28782471, 28804523, 28872461, 28898237, 28918673, 29113195, 29118814, 29268507, 29306075, 29407170, 29408308, 29952428, 30346081, 30568457, 30574760, 30783512, 30848226, 30940659, 30988806, 31015163, 31038242, 31344049, 31492158, 31501278, 31581360, 31764821		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18234959, 23442056, 25744234		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	20179236, 29663347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10226576, 11376559, 15863158, 19854294, 22421944, 26501435, 27322208, 28611202, 29130097, 30087253, 30375371, 30594239, 31180557, 31435668, 9148861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10231841, 10441008, 10471535, 10482694, 10707928, 11345133, 11870516, 14732924, 16849548, 17357279, 17786299, 17876328, 19435915, 20684793, 21057545, 22990108, 23552743, 24670043, 24886203, 25677816, 27035876, 28373289, 28454293, 29085463, 29587800, 31013436, 31177911, 31199988, 31281312, 31531884, 9788440		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	23992306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10075006, 10433194, 10850453, 11221884, 12853969, 14604900, 14672704, 15041717, 15159307, 15599946, 16257107, 16707439, 17689884, 18058470, 18082198, 19039592, 19488063, 19829035, 19903767, 19963138, 21757379, 21876965, 21914638, 22113713, 22269108, 22385796, 22658438, 22705563, 23359392, 23720424, 23975370, 25313057, 25746720, 25808168, 26095189, 26451614, 26657209, 27566588, 27604827, 27733130, 28212533, 28602980, 29108245, 29278879, 29441570, 29504694, 31575304, 31807161, 31846689, 7522082, 9137441, 9178810, 9348191, 9449654, 9486855, 9950685		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15159307, 18082198		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15937546		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	8148055		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10839293, 12353499, 15609398, 16971953, 17187359, 18328430, 18341540, 18484655, 18936038, 19566948, 19835575, 21034459, 21502924, 21528082, 21761116, 22074128, 22139024, 23088218, 23504025, 24023501, 24254308, 25118995, 25613482, 26239415, 26846663, 27178818, 27196462, 27611950, 28092842, 28148545, 28400336, 29053187, 29218244, 29344155, 29570903, 30291648, 30402844, 30453284, 30828872, 31173264, 31417548, 9195382		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19861538, 24973511, 26406959, 28393241, 31678422, 9848725		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30635938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16046050, 19004027, 23970096, 25017509, 25722217, 25728352, 26048435, 26152796, 28839463, 29349903, 29923283, 30262086, 30823924, 31413591, 7609100, 7736402, 9192977		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10226576, 10735501, 11147813, 11272093, 11285204, 11309634, 11896591, 11910473, 12032856, 12358852, 12408963, 12434133, 12438215, 12514788, 12546068, 12812985, 12893005, 14585325, 14596814, 14669355, 14691307, 14704634, 15784411, 15846079, 15863158, 15927846, 15937546, 16377175, 16450333, 1651380, 16616811, 16707439, 17016436, 17130294, 17187359, 17357279, 17476473, 17549406, 17705854, 17721995, 17768418, 17936552, 18385519, 18563556, 18598833, 18925687, 19260117, 19447103, 19582787, 19601768, 19625257, 19811770, 19863608, 19903767, 19911703, 19955655, 19963138, 20506050, 20533548, 21187523, 21590374, 21665914, 21689159, 22074128, 22447164, 22593181, 22677269, 22705563, 22724518, 22859956, 2288877, 23078766, 23167402, 23298711, 23464434, 23783250, 23792459, 23873179, 24186850, 24199791, 24477908, 24711139, 24908319, 24949437, 25118995, 25268580, 25422078, 25531323, 25613482, 25633840, 25826092, 26095189, 26152796, 26212008, 26703884, 26716641, 26873488, 27041581, 27109105, 27178816, 27259324, 27301206, 27320862, 27401062, 27519288, 27611107, 27683557, 27733130, 27872091, 28076850, 28098901, 28159748, 28274951, 28278257, 28372546, 28393241, 28446126, 28507454, 28542577, 28610976, 28611202, 28697174, 28703907, 28782471, 28791023, 28834297, 28839463, 28906311, 28993195, 28993429, 29079415, 29085463, 29186866, 29297744, 29407170, 29467947, 29481833, 29549162, 29594353, 29658391, 29663347, 29678785, 29799477, 29915022, 29973939, 29976164, 29995950, 30070319, 30226551, 30249756, 30275854, 30361387, 30448020, 30465450, 30468472, 30594239, 30602452, 30635938, 30823924, 30848226, 31109321, 31186778, 31189705, 31223316, 31356112, 31435875, 31516603, 31601153, 31678002, 31702018, 7490677, 7522082, 7736402, 9076950, 9250917, 9797013, 9887336		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	19260117		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12358852, 12514788, 15386352, 15797633, 16269171, 17332318, 17549406, 19911703, 21468579, 24195511, 26769181, 27010470, 27220278, 27748903, 28906311, 29852177, 30301599, 31435875		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10416598, 10897042, 11029459, 11147813, 12438215, 12893005, 17985359, 19844165, 21068203, 30621488, 31127990, 31825725, 7549813, 7970729, 8566583		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	12893005		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	17550376		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10375614, 12750287, 1350458, 18827819, 19079339, 19914962, 2021547, 21047769, 23054396, 23416968, 25103497, 28553282, 9148862, 9607631		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12370804, 12569017, 14755254, 15009180, 15598443, 15803361, 15913903, 15945506, 18058229, 18316602, 18848540		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	LHGDN	12598898		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	17242066, 18591412, 18606132, 21683322, 21982653, 22178754, 23291965, 23840350, 24398790, 24720641, 25113270, 25656438, 25979247, 29174139, 29198452, 31147528, 31180551, 31886938, 31936351, 32961817, 33416497, 34807419, 35052435, 35741789, 37894814, 39273142, 39596376, 40240926, 40243722, 9362480	Associate	★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	17467262, 19635970, 20067609, 22772368, 23037987, 23428920, 25113270, 27163200, 28467929, 30920150, 31147528		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	22479353, 23428920, 30920150, 36972239, 37445606	Stimulate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	21309044	Associate	★☆☆☆☆ Found in Text Mining only
Meconium ileus	Meconium ileus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7956909		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	31547819, 37821528, 8200640	Associate	★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	26204109		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10464712, 11719464, 15695386, 15975819, 16835788, 21673687, 22566144, 23792459, 27649659, 2809198, 28697174, 28763794, 29399187, 29620159		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10844567, 2056188, 22496449, 25885043, 35669782	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11278410, 15843517, 16835788, 16988787, 17096021, 17565341, 20856146, 21427239, 21464823, 21477078, 21547596, 21673687, 22307139, 23063511, 23792459, 24343358, 24727589, 24771267, 26302068, 26496168, 26569587, 26898783, 27003769, 27649659, 28678785, 29048639, 29315345, 29393387, 29620159, 31099111, 31924735, 32931642, 32968152, 33139674, 33154524, 33230298, 34367731, 34750955, 34773645, 34819356, 35909944, 35935946, 36433984, 36899279, 37240029, 37656908, 38247872, 8669474	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15843517, 17625450		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23624802, 37481560	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Amelanotic	Melanoma	Pubtator	36899279	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17565341, 25885043, 32968152, 35131256	Associate	★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	28406452		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	10547606, 9100161, 9375822		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	10638966, 1325741, 20685720, 23222509, 25681310	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19235591, 23222509, 8687119		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	19235591		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23285163	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21924590, 29131079, 29302075, 29438781		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	29708439	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36901697	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	30609805, 37686215	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20504837, 28069811, 28854149		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20384863	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29051557	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19279557, 29051557, 30350412		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28697174		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18651839, 24763824		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30121258	Associate	★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	22732936	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19559392, 24619148		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	19559392, 33541932	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	23793025		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASDB_DG	23793025		★☆☆☆☆ Found in Text Mining only
Migraine without Aura	Migraine	Pubtator	19559392	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37569523, 37626894	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	28679693	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	26345253		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	10218901		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11723175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	11723175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Morphea	Morphea	BEFREE	2023219		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	27926867	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	14607563, 18499657, 25569361, 25579378, 28811677, 36768775	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	37884924	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	12027954, 15161003, 18234959, 22103462, 23378237, 23778523, 25744234, 32630719, 33125101, 36170816	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	20571834, 22659181, 23769926, 9303017, 9761057		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	28596558, 37684266	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	20571834, 22659181, 23769926, 9761057		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11376559		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15270865, 20718783, 37506144	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18091351		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	21127203, 22955109, 23483985	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30563499		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	21689159		★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	32357547	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	24711139	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	22916837		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	32612071, 9923802	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11030205, 11418694, 15180863, 16278310, 19201832, 26056083, 26433312, 28249894, 29565496, 30854481, 32922390, 36731340, 40135312, 8634441, 9575147	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11698282, 27611810, 29602156		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11836565, 19201832		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10029100, 10218901, 10335519, 11311337, 11694328, 12507780, 15450129, 27306062, 30244922		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15450129		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18366677, 21093933, 25780887, 28103949, 28981455, 31779094, 33480235, 35094644, 35266286, 35767891, 36499320, 37219933, 39985494, 9710434	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26768647	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	10218901, 27306062, 30244922		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	10063832		★☆☆☆☆ Found in Text Mining only
Muscular dystrophy congenital, merosin negative	Congenital Muscular Dystrophy	BEFREE	16183658		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	17059371, 22431140, 27745838, 32359374, 32592467, 34360002	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	7635950	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	10063832, 16093456, 16183658, 17662584, 20655547, 22431140, 28413459, 30463013, 30884219, 31412923, 7635950		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	11876742		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	22458981, 26632886, 28265257		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	28090659		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11435325, 15860935, 16400883, 18081437, 23029178, 28090659, 29179486, 29773599		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	16400883, 18081437		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11435325, 17408459, 18081437, 29773599, 30249787, 32045384, 33050756, 33687432, 7685204, 9332304	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21189329	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25608238, 35367529	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	15726648, 16034467, 16293880, 16456374, 18349123, 22906243, 23462118, 28637665, 8977245		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21629186, 9133617		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17349636, 21288887, 21501493, 23180012, 24162813, 25644060, 25837664, 26722450		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	22119820, 23010686	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25371165		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	11703351	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	11703351	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	11703351, 29462614, 8049128		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10475771, 24533640, 36759072	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	10859282, 16543493, 17023672, 18312614, 22513132, 26319660, 26658659, 27676326, 27835972, 28055991, 28350072, 28685248, 28748762, 28883544, 29510381, 29795235, 30058704, 30317638, 30690019, 31147455, 31220469, 31276786, 31646592, 8901839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	16310260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	16718633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	18312614, 22513132, 26658659, 31147455, 38290462	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11557193, 11803605, 15378163, 22513132, 28731891, 29904415		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	15200451, 31959759	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial necrosis	Myocardial necrosis	BEFREE	28748762		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	21422001	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CTD_human_DG	21152098		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	31707807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	16807529, 34302427, 35276183, 36289352	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	17401617, 19365037, 28503426		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	10637094, 8557829, 9143260		★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	24705252, 26621707, 30429363, 31745065, 36768622	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21414848, 23049541, 24720641, 26806620	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	30764873		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	12589095, 15361357, 17882904		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	15361357, 17181107, 17424886, 18059253, 18202785, 22959364, 23375208, 23406592, 26265084, 26575862, 28779150, 29849780, 30982052		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	15361357, 1569205, 19639723, 21898422, 23663486, 27393708, 28779150, 29367682, 34953475, 36447209, 36841712, 37382248, 39744949	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25973005, 35682987	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16995954, 17368597, 18813784, 22282866, 24952889, 27733130, 28198387, 28423621, 29024700, 29620189, 29795279, 29991129, 30127876, 30546404, 30551431, 30602452, 8014102		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16995954, 20416076, 24504675, 24528033, 24952889, 25909165, 28198387, 29017171, 29991129, 30151927, 30602452, 31138194, 31328403, 32573058, 33122398, 33292168, 33752469, 34131399, 36438903, 8014102	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16556259	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	24129565, 26670709		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10075006, 10100726, 10226558, 10232610, 10233685, 10383147, 10416598, 10470251, 10839293, 10842191, 10897042, 11029459, 11163495, 11170301, 11274636, 11309634, 11345133, 11471486, 11600128, 11691800, 11719464, 11740395, 11774256, 11784716, 11896591, 12021923, 12032856, 12147741, 12202501, 12353499, 12399126, 12408963, 12434133, 12480707, 12514788, 12519076, 12581383, 12631072, 12858019, 12893005, 12941820, 1350458, 14522910, 14597578, 14597629, 14607332, 14654555, 14769885, 15009180, 15159307, 15170816, 15231647, 15389255, 15846079, 15878915, 15937546, 16135801, 16187311, 16269171, 16288038, 16292494, 16377175, 1649698, 16616811, 16819512, 16900348, 16921482, 16944977, 17018615, 17032147, 1703520, 17072348, 17072955, 17214746, 17261758, 17292826, 17336898, 17368597, 17469181, 17476297, 17503414, 17550376, 17615257, 17643425, 17671115, 17721995, 17768418, 17848193, 17893910, 17941092, 17965799, 17990985, 18058368, 18058470, 18082198, 18234959, 18241672, 18281501, 18357369, 18484655, 18522884, 18571008, 18598833, 18720060, 18774639, 18936038, 19079344, 19122679, 19169878, 19192169, 19192267, 19264227, 19264229, 19345189, 19349911, 19488063, 19657566, 19669587, 19724928, 19841536, 19861538, 19863608, 1997889, 19998449, 20026115, 20146005, 20179236, 2021547, 20506050, 21152298, 21344377, 21360479, 21527583, 21590374, 21596841, 21630266, 21697762, 21757379, 2187493, 22045191, 22074128, 22117501, 22193988, 22282866, 22421944, 22581233, 22667340, 22923201, 2295065, 22986522, 23001908, 23078766, 23088614, 23111456, 23151305, 23222509, 23298711, 23449457, 23598720, 23686306, 23828905, 23996684, 23998914, 24023501, 24121493, 24127332, 24151081, 24276590, 24441045, 24477908, 24509168, 24573955, 24651438, 24684802, 24692678, 24711139, 24740564, 24788885, 24886203, 24935594, 24992582, 25117069, 25156636, 25469981, 25480384, 25500427, 25531329, 25544767, 25557837, 25562163, 25722217, 25746720, 26003220, 26005723, 26048435, 26212008, 26267811, 26551914, 26611645, 26703884, 26716641, 26799063, 26915435, 27010470, 27036297, 27049916, 27268609, 27350089, 27356491, 27401062, 27492861, 27519288, 27626488, 27627864, 27649654, 27683557, 27733130, 27769097, 27783195, 27821145, 27840994, 27872089, 28001437, 28076850, 28098901, 28178689, 28223538, 28258635, 28263980, 28315912, 28318921, 28405157, 28412740, 28445515, 28446743, 28481870, 28512247, 28528184, 28553282, 28611202, 28638730, 28713366, 28754615, 28763794, 28791023, 28819116, 28834297, 28837142, 28983614, 29067459, 29115550, 29123964, 29151919, 29157176, 29330296, 29362917, 29414799, 29431199, 29490293, 29506142, 29549162, 29609638, 29620286, 29637003, 29742685, 29799303, 29844827, 29845746, 29886240, 29966778, 29974846, 29989060, 30013094, 30017880, 30021348, 30076136, 30116333, 30121623, 30154409, 30232222, 30233581, 30252131, 30257812, 30288358, 30444930, 30465450, 30541743, 30572269, 30594239, 30641867, 30641914, 30687089, 30696359, 30814999, 30848226, 30936073, 31081052, 31088527, 31115027, 31142059, 31173264, 31196853, 31344491, 31349076, 31409309, 31409840, 31435645, 31571988, 31650345, 31765481, 31818187, 31824844, 31835137, 7511881, 7521962, 7549813, 7609100, 7736402, 7784058, 7819128, 7833058, 7963691, 7977641, 8049128, 8253361, 8390290, 8439507, 8500096, 8565758, 8566583, 8583852, 8608973, 8698303, 8891333, 8976371, 8978341, 9076950, 9148861, 9148862, 9166292, 9192977, 9205049, 9207920, 9250917, 9387902, 9449047, 9486853, 9486855, 9515817, 9616289, 9705534, 9736807, 9851670, 9851876		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	23222509		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	17173255, 28419296, 28849172, 8441250		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	17361117	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	18300128, 36648741	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	27721022, 29204904		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	27721022, 29204904		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21378152, 24265486		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	23051628		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	25394514		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	CTD_human_DG	30818366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrosis	Nephrosis	BEFREE	30694385, 30979613		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	CTD_human_DG	10515446, 1281619, 8023968		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	11786088, 20446778	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	12454225, 20446778, 30694385, 30979613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	12454225, 12898374		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	20446793	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nervous System Diseases	Nervous system disease	Pubtator	17653872	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10666336, 10735501, 19411762, 27756784, 2809198, 28393230, 30541743, 7757990, 8143771, 8380955		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10735501, 16412560, 22382496, 24158598, 27322426, 28393230, 33252831, 33619241, 8380955	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	15895394, 26867675, 31081340, 32197075	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27756506, 28860093, 28973964		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	31570272		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	31570272		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	23703870, 29032173		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	30070388		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	32154989	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	30544111		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	LHGDN	17961177		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	10885424, 30654796		★☆☆☆☆ Found in Text Mining only
Nocturia	Nocturia	BEFREE	22658438		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	18682491, 19960420		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	26406959		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	8424449		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	14642613, 27796814, 28759733, 30581002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	29966778		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10226558, 11195465, 11318608, 12168820, 12399126, 12434133, 19380441, 20449615, 20506050, 22399565, 22699812, 23022171, 23059779, 23334061, 23435990, 23441128, 23802127, 23840350, 24258346, 24378285, 24711139, 24884715, 24992582, 25323156, 25586417, 25700356, 25963361, 25966122, 25987100, 26796257, 27000869, 27178816, 28266181, 28331344, 28405157, 28435228, 28446126, 28574846, 28581403, 28804523, 28911340, 29118814, 29123964, 29262603, 29367650, 29481833, 29700328, 29812958, 29995950, 30087284, 30112067, 30154397, 30203551, 30509963, 30599910, 30825234, 30940659, 31204561, 31387165, 31447565, 31498891, 31516619, 31638991, 31764821, 31770531, 31814893, 9255608, 9294010, 9374113		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	17032406, 21664615, 22108052, 30720468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16807982, 31595577		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17440433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	17440433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noonan Syndrome	Noonan syndrome	Pubtator	32493428	Stimulate	★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	34916229	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12219869, 12649573, 16344856, 23261458, 23824952, 26059110, 27442659, 29115082, 29660453, 31144370		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19763090, 19822955, 23404842, 26147062, 27442659, 27651382, 28542577, 29115082, 32849611, 32968152, 35631263, 36232337, 37286588, 39272990	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23857381, 25086906, 27320704	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34445187	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	10923640		★☆☆☆☆ Found in Text Mining only
Ocular Cicatricial Pemphigoid	Ocular Cicatricial Pemphigoid	BEFREE	12657600, 9268585		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	29339669	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17848193		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	30672024		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	12101112, 21171082, 21591998, 26922429, 27072267, 29457855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	20930355, 22926483, 23284772, 26107172, 26922429, 30884781, 33191095, 38554333	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	15212689	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	20179236, 29663347		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	20179236, 25273091, 29463556, 29663347	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10343777, 16542493, 16757188, 17156456, 1747946, 17827158, 18495502, 19036616, 19404930, 19890996, 20517696, 20833252, 22479506, 22653295, 22688823, 22820497, 22883423, 23597094, 24257415, 24583347, 26068512, 26395178, 26713865, 29033566, 29255496, 29315792, 30505322, 30664745, 30677026, 31232696, 31409892, 31662989, 31704612, 32452514, 32783329, 32964955, 33563308, 34058990, 34669172, 34754325, 35406794, 37075856, 37652257, 37749624, 37848267, 37904379, 39879889, 9100482	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	19852794, 24034904	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	22127703, 22662110, 34440671	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Hip	Osteoarthritis	Pubtator	22820497, 23597094, 28860542	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	23597094, 26068512, 28627979, 29145839, 31077183, 32783329	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	21353594, 22820497, 23597094, 25603974, 28860542		★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28627979, 28739110, 29145839, 30899364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	21963742	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	30664745		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	33410269	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	35113812	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	10975922, 11701443, 35798734	Associate	★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	21541994		★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	Pubtator	21541994	Associate	★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	17579298, 22975999	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10750555, 11800227		★☆☆☆☆ Found in Text Mining only
Osteopoikilosis	Osteopoikilosis	Pubtator	27267960	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10693888, 10996011, 11157141, 11357939, 11740340, 12667558, 12706579, 12938093, 14999526, 18284942, 19371798, 20052600, 22380539, 23232713, 23583365, 24315820, 25981594, 28993955, 29208173, 29860063, 30834706, 9071481, 9783545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	10693888, 10750555, 10780855, 17059371, 21200384, 28420501, 29532880, 29745905, 31081069, 32080087, 34207210, 35937796, 36443839, 36578954, 38169377, 38509680, 9783545	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	LHGDN	11740340, 17341610, 17598964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	CTD_human_DG	12706579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	12706579		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10750555, 19419264, 20052600, 22066986, 22290469, 25634187, 26205885, 28420501, 30834706		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	CTD_human_DG	10750555		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	12706579		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11955611, 25562163, 25663491, 26276504, 27097968, 27649654, 27851822, 28032372, 28177668, 28340520, 29228633, 29328361, 29577601, 30203547, 30243739, 30250537, 30779063, 30899411, 31579425, 31798828, 7472745, 7768643, 7817811, 9771482		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	16540432, 22868198, 25562163, 25663491, 25912577, 26276504, 27532429, 30779063, 31251735, 31337976, 32751693, 35806417, 36519392, 37935976, 37940978, 37993664, 38071381, 39608425, 9605020	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	8444890	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	15504545, 15726648, 16293880, 30690794		★☆☆☆☆ Found in Text Mining only
Otosclerosis	Otosclerosis	BEFREE	17588962, 18021008, 19207109, 19546831, 21777208, 23703862, 23770690, 24643032, 27404893, 29728750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Otosclerosis	Otosclerosis	LHGDN	17588962, 19113055, 19207109		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Otosclerosis	Otosclerosis	Pubtator	23703862, 25569361, 27404893, 29728750, 35418358	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22421944, 31435668		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	18505915, 21156726, 21540640, 21799915, 24452274, 29987422, 32789750, 37008951	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	31996061, 32152452	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	32152452	Stimulate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10226576, 11376559, 1330935, 15863158, 19854294, 26501435, 27322208, 28611202, 29130097, 30087253, 30375371, 30594239, 31180557, 9148861		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12743121, 12879019, 16835828, 16951150		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12496270, 12743121, 14676209, 14715418, 15498571, 1586592, 16002410, 17579858, 18714391, 19755996, 20460476, 20508647, 20699661, 20797318, 21156726, 21540640, 21799915, 21984931, 22421944, 22905131, 23178716, 23824740, 24394555, 24662327, 25137052, 25437919, 25470663, 25894377, 26130719, 26298390, 26983758, 27028996, 27141829, 27178820, 27322208, 27622658, 28064471, 28427047, 28793334, 28817834, 29257268, 29527764, 29563500, 29860390, 30061183, 30720057, 31336560, 31442208, 31540229, 32214328, 32351985, 32417846, 33149148, 33204716, 33314567, 33317907, 33568520, 33845140, 33921111, 34238029, 34238352, 34747309, 35022323, 35053353, 35186171, 35339636, 35342355, 35741755, 35882447, 36120434, 36213580, 36837407, 37476896, 37594126, 37838282, 38186569, 38267923	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18505915, 29130097, 31435668	Stimulate	★☆☆☆☆ Found in Text Mining only
Overriding aorta	Overriding aorta	BEFREE	26420484		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16388503, 25746720		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29786743		★☆☆☆☆ Found in Text Mining only
Panacinar Emphysema	Panacinar emphysema	CTD_human_DG	12634787		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10231841, 10441008, 10471535, 10482694, 10707928, 11212248, 11345133, 11870516, 12619158, 14732924, 16849548, 17357279, 17876328, 19435915, 20684793, 21057545, 22990108, 23552743, 24670043, 24886203, 25677816, 27035876, 28373289, 28454293, 29039574, 29085463, 29587800, 31013436, 31177911, 31199988, 31281312, 31531884, 9788440		★☆☆☆☆ Found in Text Mining only
Pancreatic Carcinoma	Pancreatic cancer	Pubtator	25409617	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21109948, 21624123, 21697762, 22699812, 27895310, 28608476, 31109321		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12379307, 15184872, 16933058		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17400764, 26279302, 27492861, 31272505		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	23992306		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10433946, 12140283, 12379307, 15365564, 15855639, 15970678, 16086840, 16094523, 16135802, 16519564, 17114344, 17638924, 18157915, 18239055, 18310076, 18475302, 19940030, 20684793, 20861471, 22458379, 22761868, 22869556, 23300530, 23443316, 23651239, 23969729, 24465802, 24471499, 24565114, 24619961, 25172416, 25347153, 25409617, 25882882, 26191284, 26238393, 26284758, 26464677, 26586478, 26588899, 27035876, 27435927, 27473228, 27898661, 28608476, 29157747, 29477748, 30158928, 30278585, 30334361, 30558665, 30575211, 30617137, 31061236, 31101868, 31177911, 31210298, 31261900, 31281312, 31355777, 31483844, 32291413, 32867538, 33062039, 33649780, 33782384, 33941855, 35151689, 35197444, 35222383, 35345586, 35475918, 35523176, 35538031, 35584452, 35634239, 35637952, 35854234, 36207615, 36329620, 36364317, 37086509, 37322017, 38057506, 38058074, 39212293, 40262723	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16127427, 37455016	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34857888	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	15316224, 15802940, 21509626		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15316224		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16127427	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16519564, 16680157, 17400536, 17638924, 26915435, 27473228, 37604222	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Acute Necrotizing	Pancreatitis	Pubtator	9445116	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	10400038, 16127427, 18053242, 19030200, 25278706, 30680957, 33893003	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16127431, 16680157, 17400536, 26226105, 37604222	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	11753043, 9663255		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12000730, 15802940, 15841043, 15917409, 17400536, 26226105, 29505748, 30212254, 7768393		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	15860935		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16837618, 19861538, 24190591, 24276590, 26264613, 26306431, 26406959, 26687649, 27345036, 30042377, 30076136, 30706537, 30867742, 7925100, 9848725, 9851670		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10697498, 11170301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	CTD_human_DG	20172950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	Pubtator	35350785, 36154611	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma, Squamous Cell	Papilloma	CTD_human_DG	20172950		★☆☆☆☆ Found in Text Mining only
Papillomatosis	Papillomatosis	CTD_human_DG	20172950		★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	20643858	Associate	★☆☆☆☆ Found in Text Mining only
Paramyotonia Congenita (disorder)	Paramyotonia Congenita	BEFREE	25433501		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	18326816, 30466392	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12932441, 21995845, 27756506, 28429275, 30680924, 31009074, 31085228		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31085228	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	25384022, 28978530, 30887626, 31258636		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	29324263, 29390467		★☆☆☆☆ Found in Text Mining only
Paroxysmal supraventricular tachycardia	Paroxysmal supraventricular tachycardia	BEFREE	29390467		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	11715070, 8697616		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	27442659		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	35246120	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	28656271		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	28656271	Inhibit	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29737911, 34176919, 37047060, 38488886	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	1401998, 24945093	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	35140724	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	BEFREE	12061838, 12366695, 12558956		★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	LHGDN	12061838, 12366695		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	15650893		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	19470040		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	30380353, 31726466		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Stimulate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	17376051, 26239415		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	LHGDN	17376051		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	29898177, 35360476	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	30844574		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	16824504, 17100776, 18385522		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	17100776, 22395513	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	12795790, 15972593, 17209781, 21035109, 25385297, 27396269, 30716373, 31461798		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	12795790		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	16542362, 31118359, 31978095	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25040058, 34597477	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	26847457, 32835907, 36300658	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	34601016	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29259937		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29259937		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	11786115		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	15200451	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	12748353, 21034459, 22139024, 23831330, 26192086, 28092842, 28593951, 28978530, 29571940, 29723250, 29978330, 30354670, 30728376, 30888602, 31167927, 31236971, 31431501, 31760768, 31812978, 9845827		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Fibrosis	Peritoneal Fibrosis	CTD_human_DG	17199790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	18663255	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	21034459, 25384022	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	23760290, 33508890, 37989866	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29298441		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	12478192, 14996430, 15302515, 18704440, 19858092, 20384945, 21776004, 23770939, 24841412, 25532569, 29706035, 29806152, 29891411, 31496148		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	CTD_human_DG	14996430		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	LHGDN	16734133		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	11992481, 28572674		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	11081197, 14709802		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	10079254, 10595920, 24636138, 30609812, 31109334, 9250163	Associate	★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	30567481		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	CTD_human_DG	24142982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural Diseases	Pleural diseases	Pubtator	24142982	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	19259356, 22174924	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Recessive	Polycystic kidney disease	Pubtator	34686668	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	20549648		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	12572925		★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	Pubtator	37703354	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20630504, 24874013, 25422352, 26059110, 26141422, 27796807, 27809669, 30536903		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20630504, 22904171, 27796807, 28004769, 31287539, 31745224, 32454906, 33228780, 34480296, 35551681, 35760527, 35938797, 38166771, 39773546	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35427808	Associate	★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	28521800		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	19364061	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	9143260		★☆☆☆☆ Found in Text Mining only
Polyostotic fibrous dysplasia	Polyostotic Fibrous Dysplasia	BEFREE	28285699, 30152848, 30927912		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	30392846		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	12706579		★☆☆☆☆ Found in Text Mining only
Posterior Leukoencephalopathy Syndrome	Leukoencephalopathy Syndrome	CTD_human_DG	29483653		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	CTD_human_DG	29483653		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28917156, 30997931		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11282546, 16635548, 16904244, 31557051		★☆☆☆☆ Found in Text Mining only
Priapism	Priapism	BEFREE	17408468		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	31725165		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	17158635, 17911416		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	30026087		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	26461171	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	12153156, 15726648, 16034467, 16293880, 16456374, 17157157, 18349123, 22906243, 23403314, 23462118, 28637665, 30259659		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	17157157		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	36581683	Associate	★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30390673		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	20700755, 28096433, 29074127, 30055965, 30946881		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	11992481		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	LHGDN	16704689		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	21853110, 26746014, 27019196, 27600720, 28083679, 29436636, 29578200, 30807515		★☆☆☆☆ Found in Text Mining only
PROPERDIN DEFICIENCY, X-LINKED	Properdin Deficiency, X-Linked	BEFREE	28285699, 30152848, 30927912		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10075006, 10433194, 10850453, 11221884, 12853969, 14604900, 14672704, 15041717, 15159307, 15599946, 16257107, 16707439, 17689884, 18058470, 18082198, 19039592, 19488063, 19829035, 19903767, 19963138, 21757379, 21876965, 21914638, 22113713, 22269108, 22385796, 22658438, 22705563, 23359392, 23720424, 23975370, 25224321, 25313057, 25746720, 25808168, 26095189, 26451614, 26657209, 27566588, 27604827, 27733130, 28212533, 28602980, 29108245, 29278879, 29441570, 29504694, 30556255, 31516603, 31575304, 31807161, 31846689, 7521962, 7522082, 9137441, 9140123, 9178810, 9348191, 9449654, 9486855, 9950685		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	14604900		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	12920242, 18619832, 19196965, 24311892, 24650126, 27243216, 28735516, 31694982, 33031138, 9477191	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	14604900, 16820871		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	21321977		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11248024, 12771931, 12841684, 15895377, 16203993, 16388503, 16397262, 17878531, 18507013, 18619832, 20019190, 20082326, 21030067, 21267466, 21876965, 21914638, 22142399, 22593181, 22705563, 22768240, 22791812, 22843506, 23060149, 23287991, 23515290, 23770322, 23951322, 24385212, 24418088, 24825850, 25333263, 25483191, 25622187, 25661993, 25756394, 25808168, 26021267, 26503968, 26549027, 26583432, 26683658, 27358408, 27495232, 27566588, 27604827, 28426320, 28445989, 29257105, 29278879, 29341212, 29402961, 29441570, 29500887, 29504694, 29699590, 29717114, 29807781, 29858602, 30027097, 30106153, 32364525, 33149212, 33277864, 34496240, 35686032, 35985685, 36494413, 36938549, 36999196, 37550764, 37971439, 38415559, 40312663, 8286194, 9950685	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12853969, 25746720, 9794232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14604900, 15159307, 15599946, 15905358, 16541418, 16820871, 17579118, 17689884, 18058470, 18082198, 18163430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15159307, 18082198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17579118	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	19811770		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	15906952, 17622313, 18300128, 18676351, 34194427	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	38401467	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29786743		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	18940717		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	28882457		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14527734, 15057277, 15186319, 17560118, 21135506, 22253566, 23838545, 28217129, 30429710		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	35848967	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	14527734, 17560118		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17440433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	17440433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pterygium	Pterygium	BEFREE	18203080, 22050566, 27530865, 29049722, 30908581		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	26345253		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18097622		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18496036, 20081107, 20190034, 22198906, 23937428, 26801773, 30274147, 32813135	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	17053491		★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	14514521, 14760152, 16227324, 16365456, 16456143, 16707515, 16780585, 17071067, 18670143, 19087346, 19186046, 19245428, 19797132, 19811381, 20459817, 20513241, 20683101, 21131394, 21980461, 22180562, 22206775, 22865549, 22976395, 23094028, 23148928, 23267696, 23406566, 23734748, 23886569, 24498427, 24587150, 25015975, 25745049, 27060571, 27126693, 27193053, 27323020, 27461979, 27549738, 27932875, 28284212, 28910321, 29149779, 29472603, 29986678, 30728014, 30970352, 31141166, 31343404, 31427443, 31796837, 33045470, 33510050, 34105356, 34206428, 36097589, 37533772, 37654522, 37936118	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19186046, 21908588, 22440430, 26375445, 34210319	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29289685, 34079246, 36277008	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	CTD_human_DG	12634787		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19131638, 20233420, 24043489, 28254114, 28552795, 28668545		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	31012597		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11290559, 11597910, 11884483, 11970906, 12151305, 12478192, 12858451, 16948840, 17056705, 17579094, 17934065, 18188456, 18403781, 18525195, 18583319, 1862087, 19056849, 19349911, 20846163, 21044893, 21484765, 21514399, 21882188, 22033267, 22088447, 22241478, 22451267, 22661007, 22697347, 23418199, 23500768, 23776649, 23924348, 23926107, 23973652, 24095924, 24142982, 24279830, 24333536, 24625972, 24939573, 24953558, 24958208, 24988442, 25178906, 25582705, 25584011, 26059457, 26088859, 26129822, 26216407, 26315535, 26765958, 26884454, 27036297, 27107963, 27425145, 27494713, 27522058, 27596071, 27748907, 27932059, 27989784, 28085241, 28115235, 28231275, 28244647, 28315789, 28339089, 28364627, 28365154, 28420366, 28476015, 28553231, 28557137, 28613983, 28672967, 28739343, 28810065, 28820530, 28872461, 28886261, 28940894, 29072702, 29112159, 29115860, 29116196, 29118928, 29158503, 29166374, 29207055, 29216763, 29262578, 29278701, 29532887, 29598007, 29620190, 29642520, 29666896, 29683732, 29805609, 29844390, 29873400, 29926178, 29943845, 29971947, 29976656, 29990528, 30029934, 30030077, 30082522, 30092543, 30157485, 30192650, 30212926, 30230348, 30232270, 30233503, 30257954, 30272257, 30280199, 30362537, 30370641, 30394303, 30443024, 30470772, 30527805, 30536600, 30611787, 30700849, 30709583, 30719057, 30720074, 30810263, 30890932, 30922349, 30943369, 30988156, 31005557, 31076499, 31105865, 31133649, 31162951, 31185973, 31210057, 31229901, 31295660, 31377591, 31471534, 31481891, 31488543, 31586469, 31606345, 31629729, 31695321, 31706104, 31777561, 31809714, 31820686, 31830521, 7568174, 7768393, 9808485		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	11290559, 11413354, 16365456, 1862087, 21625455, 23950911, 24574232, 24669910, 24958208, 26088859, 27107963, 28128990, 29207055, 30155985, 31085559, 31335245, 32102576, 33325804, 34080651, 35008594, 35170357, 35482476, 37002627, 37724521, 37731513, 37898439, 37944440, 38084409	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15133032		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	15286001, 16324872, 16365456, 17266442, 19817698, 24762191, 26817844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25226160, 33361096, 37822112	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	11426486		★☆☆☆☆ Found in Text Mining only
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21068203, 28333014		★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	BEFREE	31190981		★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	HPO_DG			★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	15860935, 21352343, 7757990		★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	16288038		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	12686863, 26749573, 29079415		★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	27756506		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12686863, 12970754, 1404666, 17032147, 18357369, 18709334, 19493342, 21150720, 25909813, 26631499, 26749573, 27806310, 28363829, 28881668, 29289594, 29568359, 29772238, 30171816, 31729097, 31848806, 9166292		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15365652		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	11073823		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	15086490, 15199407, 15536170, 15769863, 16086153, 17300978, 18509316, 18753303, 19543302, 19786738, 20709799, 21079788, 21927575, 22211842, 22266139, 22338084, 22889746, 23022526, 23027874, 23486519, 23515048, 23576639, 23656889, 23781031, 23991195, 24088962, 24113078, 24114659, 24613410, 24854279, 25176603, 25343824, 25439793, 25480384, 25658916, 26142335, 26257513, 26444031, 26464640, 26616407, 26919280, 27108839, 27112839, 27161221, 27245114, 27829579, 27882817, 27916681, 27951565, 28105508, 28152529, 28228400, 28350874, 28387228, 28411025, 28422762, 28458345, 28483378, 28646304, 28709131, 28733250, 28805491, 28839221, 28848189, 28875388, 28922731, 29026167, 29039466, 29101337, 29102563, 29197622, 29230704, 29309828, 29311449, 29311960, 29436600, 29484381, 29518614, 29530599, 29620271, 29723529, 29723660, 29743665, 29789348, 29921370, 29928482, 29960018, 29973206, 30054990, 30066965, 30095214, 30125566, 30127380, 30308195, 30333225, 30425453, 30453174, 30539648, 30760641, 31059771, 31211499, 31512238, 31545406, 31655312, 31781203, 31825802, 31836508		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	11140698, 12454225, 15191521, 8441250		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	11008076, 11803605, 15694998, 15942255, 17205957, 18293167, 22322241, 23051628, 29549584, 29794429, 29993184, 9507209		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12654639, 22034170, 26088859, 28498479, 28870868, 29077160, 29102631, 30395619, 31335733, 31471534		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	12654639		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29077160, 31258705		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	26542979, 33552042	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	25803862, 32567428	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	16704689	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29505922, 30186476		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	24075003	Stimulate	★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 1	Retinitis Pigmentosa	BEFREE	24373620		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10897042, 28633655, 30257992, 7511881, 7732011, 7952399, 8562485		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	19001221	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	8641969	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31240212		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12974945, 15899124, 19264227, 23665678, 26291313, 27008654, 8380955		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	12974945, 20219075, 25806826, 8380955	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	30561135		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	15215809, 27118427, 27344599, 30697920		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	LHGDN	18303197		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	18303197, 20235205, 28323847, 30697920	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11966774, 12176809, 12563678, 15695537, 15794197, 16564576, 17594488, 18693126, 19279017, 20047981, 2109776, 21113716, 21352343, 22129793, 22513132, 22682473, 23645040, 24315820, 25378349, 25934826, 26147289, 26799059, 27214848, 27692391, 27865758, 28234629, 29088724, 30543834, 30839312, 30864698, 31297660, 31498070, 31541390, 7757990, 8702433, 9645608		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15794197, 18674744		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	1569205, 18201469, 22201619, 23884466, 33596578, 34445093, 35190755, 36032502	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	24830974, 26546895	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	26708394	Stimulate	★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	22904198		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	29393349, 29614203, 31444797		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	10879745	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11436536, 12068984, 17785866, 29679363, 31012597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	LHGDN	12068984, 17785866		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	CTD_human_DG	17785866		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	21148227, 22209793, 26445225	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	18506556, 36005179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	27008654, 29896199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	28030800, 29328472, 35739280	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37993664	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15855173, 27208691, 9057628	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	24294365, 28829837, 29020987, 35151264	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	34853077	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	18097622		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24065520, 26481614, 27847927, 30389222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24065520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24702465, 30468562, 36632818	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24984193	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	12117671, 14712301, 1520334, 15641096, 15818662, 15855645, 16301681, 17195236, 17469184, 2023219, 20517890, 21352343, 21484765, 22700848, 22740248, 30207074, 7798629		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	19812599, 28681919, 29858547, 37580109	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	2307855	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10809757, 11710721, 12428243, 12905481, 17907149, 19536281, 20190732, 21569507, 24574232, 26357964, 26360820, 27054717, 28298564, 29616048, 30075746, 31156645, 31840182, 31861245, 32071084, 33140521, 34504485, 7636314, 9540985	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	11278244, 18676351	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	30079294, 31827250	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	LHGDN	16135988		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	23446766		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	30026087		★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	26076859	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10927795, 7595653		★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	16003065		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20207161, 29391140, 30214506		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10100726, 10470251		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	17401617, 19060265, 19365037, 23325483		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	25119712		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	19497778		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	12546068		★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	31039138		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	27297622		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30707337		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	27380173		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	27380173	Associate	★☆☆☆☆ Found in Text Mining only
Sinus Node Dysfunction (disorder)	Sinus Node Dysfunction	BEFREE	21493874		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12560464, 14872501, 15027908, 27142093, 30598637, 31925325, 35705251, 36999025, 9038756, 9867125	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15908402	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	29858547, 36672844, 7636314	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	24315820		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	15057277, 15908402, 20100197, 21135506, 22803775, 22935165, 26878989		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	17768418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	22002724, 35886018	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	8148055		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	20847078, 28619958, 34239024, 34916229, 36265878	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32380702	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32968152	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	18355347		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28465478, 30784906		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	14747535	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	33568351	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12399126, 16499994, 23592755, 30965130, 8388229, 8696721		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	10098728, 26823791, 31113982, 32764738, 35838343, 40022030, 8388229, 8624260	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8180008	Inhibit	★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	20513817		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	24713395, 30262154		★☆☆☆☆ Found in Text Mining only
Snowflake vitreoretinal degeneration	Snowflake vitreoretinal degeneration	BEFREE	28470822		★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	31741027		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	28060908		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Degeneration	Spinocerebellar Degeneration	BEFREE	27756506		★☆☆☆☆ Found in Text Mining only
Spinocerebellar tract degeneration	Spinocerebellar Degeneration	BEFREE	27756506		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	29900045		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	10996011, 26799059		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16180249, 38634365	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	33410269	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	9783545	Associate	★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	23755232		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15009180, 28881597		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11195465, 17936552, 18234959, 18418730, 19260117, 21429769, 23441128, 24278120, 24954139, 25503133, 25710582, 26990749, 27748903, 28537671, 28898237, 29206939, 29462614, 8111720, 8891333		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14712482, 15033492, 15231647, 17023741, 17217620, 17680270, 17990985, 18202754, 19082463		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	20852150		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17680270, 17990985, 20012971, 22314103, 23078766, 24747824, 25175594, 25544767, 28652766, 30280774, 30756445, 31571988		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12373600, 15161003, 15247230, 16478646, 17217620, 18234959, 18472963, 22641218, 23370231, 24278120, 2478181, 25064463, 25130698, 25240937, 25275298, 26205654, 26497215, 26861993, 28035402, 28052009, 28053372, 28537671, 29490660, 29719198, 31364119, 31570856, 31906769, 31970439, 32107458, 32171324, 32362625, 32439976, 32572882, 32623386, 32928102, 33066067, 33173143, 33227411, 34060226, 34309966, 34599215, 34781814, 35830713, 36148955, 36425786, 36586077, 36737832, 37459093, 37691034, 39375732	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21264308, 21442435, 27567435, 34847839	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27667357		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	20179236		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24203162, 31807020		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12581383, 15170816, 18441156, 18457660, 19351843, 19841536, 20308003, 22667340, 25531329, 28318921, 29541402, 30096190, 30906472		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21726607, 26205654, 26764364, 30565803, 30906472		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	21524750, 9264495		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16344856, 19401628, 21664615, 28811292, 30581002, 31087761		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29896199		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10562360, 10839293, 12353499, 14669355, 15609398, 16971953, 17187359, 18328430, 18341540, 18484655, 18936038, 19566948, 19835575, 21034459, 21502924, 21528082, 21761116, 22074128, 22139024, 23088218, 23504025, 24023501, 24254308, 25118995, 25613482, 26239415, 26846663, 27178818, 27196462, 27611950, 28092842, 28148545, 28400336, 29053187, 29218244, 29344155, 29570903, 30291648, 30402844, 30453284, 30828872, 31173264, 31417548, 9195382, 9250917		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	14595120, 34104107, 7493912	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10376964, 10839293, 11543663, 12353499, 12971256, 1312080, 1386559, 14669355, 15033661, 15609398, 16055706, 16101328, 16987993, 17601708, 18328430, 18484655, 18593586, 19566948, 19835575, 21034459, 21110833, 21528082, 21761116, 21863023, 22571197, 22590977, 23188426, 23285052, 23365642, 23504025, 23690936, 23723999, 23934170, 24023501, 24120241, 25286029, 25391430, 25813152, 25839162, 26176983, 26482611, 26576674, 26627200, 26754079, 26846663, 27178818, 27196462, 27383203, 28165563, 28338195, 28743116, 29271006, 29363915, 29391307, 30402844, 31092242, 31210301, 31277152, 31417548, 31799659, 31905487, 32529872, 32754268, 33069758, 33178362, 33189777, 33247701, 33274798, 33508890, 33538080, 34247571, 34260413, 34332586, 34379688, 34413861, 34746312, 34895039, 35082283, 35458126, 35511773, 35596183, 35848483, 36453704, 36838713, 37312587, 37318594, 37340903, 37416765, 37431884, 37434402, 37573302, 37707957, 37989866, 38200441, 39394072, 39457390, 8142266, 8641969, 9119743, 9210400, 9250917, 9364301, 9823982	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15609398, 17187359, 18341540		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20529313, 30226558, 30255106	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	9183654		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	30672024		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	34916229	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	15778708, 26867675	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subcapsular cataract	Subcapsular cataract	BEFREE	15161862, 9449696		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	21741294	Associate	★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	34244757	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30707337		★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	16696316		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	29020987, 30707337		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12117671, 12207584, 12858451, 14712301, 1498091, 15104684, 1520334, 15641096, 15818662, 15855645, 16301681, 17195236, 17469184, 18408251, 2023219, 20517890, 21352343, 21484765, 21636803, 22403442, 22700848, 22740248, 22890162, 2307855, 23864144, 24998426, 25876876, 27054717, 27965520, 28062404, 29311148, 29676521, 29805609, 30075746, 30150989, 30207074, 30270117, 30536805, 30758773, 30870448, 30954335, 31625918, 31840939, 7798629		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	20551174		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	10208456, 16301119, 21429769, 30272315, 9072558		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	15994879, 21967607, 22310796, 22553411, 23772771, 24098321, 24603890, 29932521, 35343049, 35456471	Associate	★☆☆☆☆ Found in Text Mining only
Telangiectasia, Hereditary Hemorrhagic, Type 1	Telangiectasia	BEFREE	15907823		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	22000099		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	29136085		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	21126344	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	17220333		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	23032507	Associate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	24443223, 27882423, 30655554		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	23334061, 37042257	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	15682418	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	14687032, 15682418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocythemia, Essential	Thrombocythemia	CTD_human_DG	15682418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Thrombocytopenia	Pubtator	10606887	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis, Autosomal Dominant	Thrombocytosis	CTD_human_DG	15682418		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	22286157, 24402195		★☆☆☆☆ Found in Text Mining only
Thrombophlebitis	Thrombophlebitis	Pubtator	21478096	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	16931622	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	19234339, 30414981, 30947333		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17003485, 17296934, 23591524, 23918305, 26264613, 26687649, 27345036, 30042377, 33905626, 35871446	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25927212, 33905626	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35118633	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10459856, 16288728, 19861538, 24973511, 26406959, 28393241, 31678422, 7925100, 9848725, 9851670		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30171257	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	18190611		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29131274	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	26406959, 8077617		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12432546		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16837618, 19861538, 24973511, 26406959, 28393241, 31678422, 9848725		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25927212, 26678064, 27507052, 28393241, 30171257, 32337286, 32698816, 35118633	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26406959	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	LHGDN	14737114		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	19138047, 26306431		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	18190611, 27345036, 36834770	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25130698	Associate	★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	27058240	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	1703520		★☆☆☆☆ Found in Text Mining only
Tracheal Stenosis	Tracheal Stenosis	BEFREE	16685022, 28584818		★☆☆☆☆ Found in Text Mining only
Tracheal Stenosis	Tracheal Stenosis	LHGDN	16685022		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	17296440, 23403865, 30272315		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	24443223		★☆☆☆☆ Found in Text Mining only
Trichuriasis	Trichuriasis	Pubtator	28284979	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23049873, 25824321, 28674186, 28754615, 29362917, 30004628, 32196606, 32303620, 32357907, 33294922, 33461373, 33674749, 34299315, 34326372, 34481843, 34897916, 35115500, 35199941, 35377948, 36594086, 39593161	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25824321, 26232605, 26637807, 28528184, 28754615, 29358127, 29414799, 29777109, 31091437, 31190817, 31621381		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26703884	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39206896	Stimulate	★☆☆☆☆ Found in Text Mining only
Trismus	Trismus	BEFREE	23891529		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	29462614, 8049128		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	24142982		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	32493700, 32620917	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	17985359		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12438215, 17367219, 18186562, 19285572, 28088612, 28993955, 29794741, 8613031, 8726826, 8978341		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17404043, 18186562		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12417722		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20452036		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	26954016		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	CTD_human_DG	19092814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ureteral Obstruction	Urethral obstruction	Pubtator	10594789	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	16367920	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neck Obstruction	Urinary bladder neck obstruction	Pubtator	28138557	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16412233, 18311384, 23251617, 24078506, 25722217, 25928257, 26152796, 26684800, 26784156, 26988652, 28081738, 29312460, 29321082, 29349903, 29636362, 29752880, 30066698, 31174611, 31238579, 32650766, 32841548, 33200222, 33459039, 33516780, 34116604, 34354794, 34975891, 35746836, 35777025, 37453055, 37461061, 38058082	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25132950, 9192977	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	35662268	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	31059065	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	33836021	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Retention	Urinary retention	Pubtator	8567993	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	24448750		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	19138248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	22072501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	8088612	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	27010470		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11509647, 19344999, 20565840, 23587428, 23873179, 24047375, 25273091, 25786122, 26769181, 27220278, 27721577, 27916907, 28446743, 28906311, 29180690, 29237907, 29337896, 30908730, 31119955, 31205451, 31435875, 31546735, 31951596, 32596357, 33098235, 33649791, 33935123, 35345518, 36070413, 37004067, 37350664, 38056236, 40141056	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15047811	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	2168964	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	33313721	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10566662, 11158066, 12548199, 12629129, 16571622		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	10469047	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	20591073	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	15838489, 21478096, 37916368	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	33482378	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	21478096, 27329669		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	35440618, 36787443	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10867335, 11391236, 14684682, 15200451, 15381201, 15381204, 20650904, 30012290, 31702496, 9185506, 9366572		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	12457461, 15200451, 20368328, 28258189, 28628273, 40240926	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	15200451		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	8675633	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	1328302	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	14697748		★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	28951703		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	11700497, 19560950, 31886225	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	35808901	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31766450		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	15049387, 22136666, 32108968, 36632818	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	21126621	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	15086490	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	17251317, 20214667, 23583823, 23871585, 25298166, 27126693, 30971721, 30984775, 34946964, 38290462, 39457420	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	15086490, 17597658, 17707032, 18685869, 31832877		★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	LHGDN	17597658, 17707032		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	15086490, 17597658, 18685869, 19861314, 22558067, 31832877		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28703134, 29701163, 29857907		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	26370050		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	26370050	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	29974998	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	26370050		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	16704689, 21858467, 22550395, 24607896, 28625142, 31069271, 32638535, 34032608, 36494806, 39486365	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10232610		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	10906512, 27018284		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31035970, 7656270, 9223327	Associate	★☆☆☆☆ Found in Text Mining only