TEX53 (testis expressed 53)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 105376230 |
| Gene name | Testis expressed 53 |
| Gene symbol | TEX53 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 9 |
| Chromosome location | 9q32 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A1B0GU33 |
| Protein name | Testis-expressed protein 53 |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in Testis. {ECO:0000305}. |
| Sequence |
MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRM |
| Sequence length | 70 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TEX53 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TEX53 (see Related Genes above), that are NOT already directly curated for TEX53 itself -- a lead worth checking, not a confirmed association.
0
|
|