TEX46 (testis expressed 46)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 729059
Gene name Testis expressed 46
Gene symbol TEX46
Synonyms (NCBI Gene)
C1orf234TEX#
Chromosome 1
Chromosome location 1p36.12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0007338 Process Single fertilization IEA
GO:0007338 Process Single fertilization ISS
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H3BTG2
Protein name Testis-expressed protein 46
Protein function Essential for male fertility, sperm head formation and sperm penetration through the egg zona pellucida.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17671 DUF5531 54 → 120 Family of unknown function (DUF5531) Family
PF17671 DUF5531 2 → 58 Family of unknown function (DUF5531) Family
Tissue specificity TISSUE SPECIFICITY: Testis-specific. {ECO:0000305}.
Sequence 
MSLHGILASAGTIGAVAAWLMSYKPALFGFLFLLLLLSNWLVKYEHKLTLPEPQQDEILQ
RLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSP
S
Sequence length 121
Interactions View interactions

No strongly related genes found yet for TEX46.

No additional diseases found yet through genes similar to TEX46.