TEX38 (testis expressed 38)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 374973
Gene name Testis expressed 38
Gene symbol TEX38
Synonyms (NCBI Gene)
ATPAF1-AS1C1orf223THEG4
Chromosome 1
Chromosome location 1p33
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017677 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane ISS
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621126 29589 ENSG00000186118
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PEX7
Protein name Testis-expressed protein 38 (ATPAF1 antisense RNA 1) (ATPAF1 antisense gene protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15834 THEG4 13 → 205 Testis highly expressed protein 4 Family
Sequence 
MDSQQEDLRFPGMWVSLYFGILGLCSVITGGCIIFLHWRKNLRREEHAQQWVEVMRAATF
TYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLDIPEGRSHADQDSNP
KAEAPAPLQPALQLAPQQPQARSPFPLPIFQEVPFAPPLCNLPPLLNHSVSYPLATCPER
NVLFHSLLNLAQEDHSFNAKPFPSEL
Sequence length 206
Interactions View interactions

No strongly related genes found yet for TEX38.

No additional diseases found yet through genes similar to TEX38.