Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51368
Gene name	Testis expressed 264, ER-phagy receptor
Gene symbol	TEX264
Synonyms (NCBI Gene)	ZSIG11
Chromosome	3
Chromosome location	3p21.2

38 Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048446	hsa-miR-100-5p	CLASH	23622248
MIRT037352	hsa-miR-877-5p	CLASH	23622248
MIRT1419557	hsa-miR-3125	CLIP-seq
MIRT1419558	hsa-miR-3173-3p	CLIP-seq
MIRT1419559	hsa-miR-361-3p	CLIP-seq
MIRT1419560	hsa-miR-3916	CLIP-seq
MIRT1419561	hsa-miR-4476	CLIP-seq
MIRT1419562	hsa-miR-4533	CLIP-seq
MIRT1419563	hsa-miR-1254	CLIP-seq
MIRT1419564	hsa-miR-1909	CLIP-seq
MIRT1419565	hsa-miR-3116	CLIP-seq
MIRT1419566	hsa-miR-4254	CLIP-seq
MIRT1419567	hsa-miR-4271	CLIP-seq
MIRT1419568	hsa-miR-4725-3p	CLIP-seq
MIRT2126074	hsa-miR-3119	CLIP-seq
MIRT2126075	hsa-miR-3690	CLIP-seq
MIRT1419566	hsa-miR-4254	CLIP-seq
MIRT2126076	hsa-miR-4314	CLIP-seq
MIRT2126077	hsa-miR-4778-5p	CLIP-seq
MIRT2126078	hsa-miR-671-5p	CLIP-seq
MIRT2348042	hsa-miR-1291	CLIP-seq
MIRT2348043	hsa-miR-149	CLIP-seq
MIRT2348044	hsa-miR-2114	CLIP-seq
MIRT2348045	hsa-miR-3176	CLIP-seq
MIRT2348046	hsa-miR-3192	CLIP-seq
MIRT2348047	hsa-miR-328	CLIP-seq
MIRT2348048	hsa-miR-3922-3p	CLIP-seq
MIRT2348049	hsa-miR-4268	CLIP-seq
MIRT2348050	hsa-miR-4292	CLIP-seq
MIRT2348051	hsa-miR-4300	CLIP-seq
MIRT2348052	hsa-miR-4308	CLIP-seq
MIRT2348053	hsa-miR-920	CLIP-seq
MIRT2126074	hsa-miR-3119	CLIP-seq
MIRT2126075	hsa-miR-3690	CLIP-seq
MIRT1419566	hsa-miR-4254	CLIP-seq
MIRT2126076	hsa-miR-4314	CLIP-seq
MIRT2126077	hsa-miR-4778-5p	CLIP-seq
MIRT2126078	hsa-miR-671-5p	CLIP-seq

32 Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IBA
GO:0000421	Component	Autophagosome membrane	IDA	31006537, 31006538
GO:0000421	Component	Autophagosome membrane	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32152270, 32296183, 34524948
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	32152270
GO:0005634	Component	Nucleus	IEA
GO:0005657	Component	Replication fork	IBA
GO:0005657	Component	Replication fork	IDA	32152270
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	31006537, 31006538
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA	32152270
GO:0005829	Component	Cytosol	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0016020	Component	Membrane	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0038023	Function	Signaling receptor activity	IDA	31006538
GO:0061709	Process	Reticulophagy	IBA
GO:0061709	Process	Reticulophagy	IDA	31006538
GO:0061709	Process	Reticulophagy	IMP	31006537, 31006538
GO:0106300	Process	Protein-DNA covalent cross-linking repair	IBA
GO:0106300	Process	Protein-DNA covalent cross-linking repair	IDA	32152270

MIM	HGNC	e!Ensembl
620608	30247	ENSG00000164081

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q9Y6I9
Protein name	Testis-expressed protein 264 (Putative secreted protein Zsig11)
Protein function	Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes fo
PDB	7VEC , 7VED
Family and domains
Sequence	MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGET GRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGF KVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHF MCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSA ATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK WLWEPTAPEKGKE
Sequence length	313
Interactions	View interactions

Reactome Pathway
Platelet degranulation

Related Genes Genes most often co-reported with TEX264 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TEX264.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TEX264 (see Related Genes above), that are NOT already directly curated for TEX264 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TEX264.

TEX264 (testis expressed 264, ER-phagy receptor)