TEX13B (testis expressed 13B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 56156
Gene name Testis expressed 13B
Gene symbol TEX13B
Synonyms (NCBI Gene)
TGC3BTSGA5
Chromosome X
Chromosome location Xq22.3
Summary This gene is similar to a mouse gene that is expressed in the testis. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017579 hsa-miR-335-5p Microarray 18185580
MIRT2347970 hsa-miR-4256 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003729 Function MRNA binding IBA
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300313 11736 ENSG00000170925
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXU2
Protein name Testis-expressed protein 13B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15186 TEX13 5 → 154 Testis-expressed sequence 13 protein family Family
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence 
MALRPEDPSSGFRHGNVVAFIIEKMARHTKGPEFYFENISLSWEEVEDKLRAILEDSEVP
SEVKEACTWGSLALGVRFAHRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEM
ECNEATFQLQLTETSLAEVQRERDMLRWKLFHAELAPPQGQGQATVFPGLATAGGDWTEG
AGEQEKEAVAAAGAAGGKGEERYAEAGPAPAEVLQGLGGGFRQPLGAIVAGKLHLCGAEG
ERSQVSTNSHVCLLWAWVHSLTGASSCPAPYLIHILIPMPFVRLLSHTQYTPFTSKGHRT
GSNSDAFQLGGL
Sequence length 312
Interactions View interactions

No strongly related genes found yet for TEX13B.

No additional diseases found yet through genes similar to TEX13B.