TEX13A (testis expressed 13A)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 56157
Gene name Testis expressed 13A
Gene symbol TEX13A
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xq22.3
Summary This gene is similar to a mouse gene that is expressed in the testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019268 hsa-miR-148b-3p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0008270 Function Zinc ion binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300312 11735 ENSG00000268629
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXU3
Protein name Testis-expressed protein 13A
Protein function Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Plays a role in transcriptional repression (By similarity). Required for rapid sperm motility and timely degradation of mRNA via its interaction with CNOT1 (By simi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15186 TEX13 5 → 148 Testis-expressed sequence 13 protein family Family
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence 
MALRPEDPSSGFRHSNVVAFINEKMARHTKGPEFYLENISLSWEKVEDKLRAILEDSEVP
SEVKEACTWGSLALGVRFAHRQAQLQRHRVRWLHGFAKLHKSAAQALASDLKKLREQQET
ERKEAASRLRMAQTSLVEVQKERDKELVSPHEWEQGAGWPGLATAGGVCTEGAAEEEEEA
AVAAAGAAGGKGAEEEQRDVEVVAAPVEAMAPPVEAGAAPMETQFPHVEARAASMETTEK
LERILLQLLGDADQEKYTYWGQKEGDLRSVETATSYFSGTTNPWSRASSEPLPVQLPASY
SYSYSSPFSSFSDIPTISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRD
RRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDCGKGIWLQKPH
Sequence length 409
Interactions View interactions

No strongly related genes found yet for TEX13A.

No additional diseases found yet through genes similar to TEX13A.