TENT5B (terminal nucleotidyltransferase 5B)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 115572
• Gene name: Terminal nucleotidyltransferase 5B
• Gene symbol: TENT5B
• Synonyms (NCBI Gene): FAM46, FAM46B
• Chromosome: 1
• Chromosome location: 1p36.11

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 19060904, 23275563, 25416956, 25814554, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	32009146
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	32009146
GO:0005737	Component	Cytoplasm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	30532005
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	32009146
GO:0045727	Process	Positive regulation of translation	IMP	32009146
GO:0045786	Process	Negative regulation of cell cycle	IMP	30532005
GO:0048255	Process	MRNA stabilization	IBA
GO:1990817	Function	Poly(A) RNA polymerase activity	IBA
GO:1990817	Function	Poly(A) RNA polymerase activity	IDA	32009146
GO:1990817	Function	Poly(A) RNA polymerase activity	IEA

Other IDs

• MIM: 619069
• HGNC: 28273
• e!Ensembl: ENSG00000158246

Protein

• UniProt ID: Q96A09
• Protein name: Terminal nucleotidyltransferase 5B (EC 2.7.7.19) (Non-canonical poly(A) polymerase FAM46B)
• Protein function: Catalyzes the transfer of one adenosine molecule from an ATP to an mRNA poly(A) tail bearing a 3'-OH terminal group in an ATP hydrolysis-dependent manner (PubMed:32009146, PubMed:34048638). May be involved in maintaining the translation efficien
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07984	NTP_transf_7	52 → 372	Nucleotidyltransferase	Domain

• Sequence:

  MMPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRL
  DALLSEPIPIHGRGNFPTLSVQPRQIVQVVRSTLEEQGLHVHSVRLHGSAASHVLHPESG
  LGYKDLDLVFRVDLRSEASFQLTKAVVLACLLDFLPAGVSRAKITPLTLKEAYVQKLVKV
  CTDSDRWSLISLSNKSGKNVELKFVDSVRRQFEFSIDSFQIILDSLLLFGQCSSTPMSEA
  FHPTVTGESLYGDFTEALEHLRHRVIATRSPEEIRGGGLLKYCHLLVRGFRPRPSTDVRA
  LQRYMCSRFFIDFPDLVEQRRTLERYLEAHFGGADAARRYACLVTLHRVVNESTVCLMNH
  ERRQTLDLIAALALQALAEQGPAATAALAWRPPGTDGVVPATVNYYVTPVQPLLAHAYPT
  WLPCN

• Sequence length: 425

Related Genes

No strongly related genes found yet for TENT5B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TENT5B.