Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	150483
Gene name	Tektin 4
Gene symbol	TEKT4
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q11.1

miRTarBase ID	miRNA	Experiments	Reference
MIRT017880	hsa-miR-335-5p	Microarray	18185580

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 25416956, 29892012, 31515488, 32296183, 36217029
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005929	Component	Cilium	IEA
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0030030	Process	Cell projection organization	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IBA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0060271	Process	Cilium assembly	IBA
GO:0060294	Process	Cilium movement involved in cell motility	IBA
GO:0060294	Process	Cilium movement involved in cell motility	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	ISS

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8WW24

Protein name

Tektin-4

Protein function

Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia and flagellar axoneme (PubMed:36191189). Forms filamentous polymers in the walls of ciliary and flagellar microtubules (By similarity). Contributes

PDB

7UNG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03148	Tektin	44 → 426		Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in spermatozoa. Also detected at low levels in pancreas. Expressed in airway epithelial cells (PubMed:36191189). {ECO:0000269|PubMed:17244819, ECO:0000269|PubMed:36191189}.

Sequence

MAQTVPPCELPCKEYDVARNTGAYTSSGLATASFRTSKYLLEEWFQNCYARYHQAFADRD
QSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLL
AQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKR
TIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESAS
TPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELE
DARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDA
AQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMA
HRTRYPTILQLAGYQ

Sequence length

435

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PARKINSON DISEASE	—	GWAS catalog	34064523	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Asthenozoospermia	Asthenozoospermia	BEFREE	17244819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24823476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24823476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37694353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37694353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24823476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30251060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	17244819		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with TEKT4 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TEKT4.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TEKT4 (see Related Genes above), that are NOT already directly curated for TEKT4 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TEKT4.

TEKT4 (tektin 4)

Bookmark This Gene