TDRG1 (testis development related 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 732253 |
| Gene name | Testis development related 1 |
| Gene symbol | TDRG1 |
| Synonyms (NCBI Gene) |
LINC00532lincRNA-NR_024015
|
| Chromosome | 6 |
| Chromosome location | 6p21.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q3Y452 |
| Protein name | Testis development-related protein 1 |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in the testis but not in any other non-reproductive tissues (at protein level). Mainly located in spermatogenic cells in seminiferous tubules of adult testis. {ECO:0000269|PubMed:22123530}. |
| Sequence |
MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGS |
| Sequence length | 100 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with TDRG1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to TDRG1 (see Related Genes above), that are NOT already directly curated for TDRG1 itself -- a lead worth checking, not a confirmed association.
0
|
|