TDH (L-threonine dehydrogenase (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 157739
Gene name L-threonine dehydrogenase (pseudogene)
Gene symbol TDH
Synonyms (NCBI Gene)
SDR14E1P
Chromosome 8
Chromosome location 8p23.1
Summary This gene appears to be an evolving pseudogene of L-threonine 3-dehydrogenase (TDH). In both prokaryotes and eukaryotes, TDH catalyzes the first of two steps in one of two L-threonine degradation pathways. However, in human, the single gene with sequence
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615174 15547 ENSG00000293451
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZJ6
Protein name Inactive L-threonine 3-dehydrogenase, mitochondrial (Short chain dehydrogenase/reductase family 14E member 1 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01370 Epimerase 54 → 217 NAD dependent epimerase/dehydratase family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined. Detected in most cell types examined, but not observed in endothelial cells, glioma cell lines and some leukemia cell lines. {ECO:0000269|PubMed:12361482}.
Sequence 
MLFIRMLRRAGQSPACGCWTPVLPVRFLGISPRQIPADANFHSASFSDTDHPRVLITGAL
GQLGVGLANLLRKRFGKDSVILSDIRKPPDHVFHSGPFIYSDILDYKNLREIVVNNRITW
LFHYSALLSAFGEANVSLARAVNITGLHNILDVAAEHNLQLFVPSTIGAFGPTSPRNPTP
DLCIQRPRTIYGVSKVHAELMGETMQSRFSMMPQSMANSSATWKPARDCP
Sequence length 230
Interactions View interactions

No strongly related genes found yet for TDH.

No additional diseases found yet through genes similar to TDH.