TDG (thymine DNA glycosylase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6996
• Gene name: Thymine DNA glycosylase
• Gene symbol: TDG
• Synonyms (NCBI Gene): hTDG
• Chromosome: 12
• Chromosome location: 12q23.3
• Summary: The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaire

miRNA Show/Hide all (520)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001921	hsa-miR-29c-3p	Luciferase reporter assay	18390668
MIRT001921	hsa-miR-29c-3p	Luciferase reporter assay	18390668
MIRT001921	hsa-miR-29c-3p	Reporter assay;Other	18390668
MIRT024737	hsa-miR-215-5p	Microarray	19074876
MIRT026661	hsa-miR-192-5p	Microarray	19074876
MIRT046007	hsa-miR-125b-5p	CLASH	23622248
MIRT045731	hsa-miR-125a-5p	CLASH	23622248
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT053293	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT053293	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT053293	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT001921	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT001921	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT001921	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT438638	hsa-miR-26a-5p	Luciferase reporter assay	24114270
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT438638	hsa-miR-26a-5p	Luciferase reporter assay	24114270
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT053292	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT184198	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT466500	hsa-miR-4422	PAR-CLIP	21572407
MIRT184196	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT466498	hsa-miR-4693-3p	PAR-CLIP	21572407
MIRT466496	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT053292	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT053293	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT001921	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT184198	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT466500	hsa-miR-4422	PAR-CLIP	22012620
MIRT184196	hsa-miR-4712-3p	PAR-CLIP	22012620
MIRT466498	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT466497	hsa-miR-3671	PAR-CLIP	22012620
MIRT466496	hsa-miR-493-5p	PAR-CLIP	22012620
MIRT053292	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT053293	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT001921	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT184198	hsa-miR-6835-3p	PAR-CLIP	23592263
MIRT466500	hsa-miR-4422	PAR-CLIP	23592263
MIRT466499	hsa-miR-3646	PAR-CLIP	23592263
MIRT184195	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT184196	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT466498	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT466497	hsa-miR-3671	PAR-CLIP	23592263
MIRT466496	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT184198	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT466500	hsa-miR-4422	PAR-CLIP	21572407
MIRT184196	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT466498	hsa-miR-4693-3p	PAR-CLIP	21572407
MIRT466496	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT053292	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT053293	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT001921	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT184198	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT466500	hsa-miR-4422	PAR-CLIP	22012620
MIRT184196	hsa-miR-4712-3p	PAR-CLIP	22012620
MIRT466498	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT466497	hsa-miR-3671	PAR-CLIP	22012620
MIRT466496	hsa-miR-493-5p	PAR-CLIP	22012620
MIRT053292	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT053293	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT001921	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT184198	hsa-miR-6835-3p	PAR-CLIP	23592263
MIRT466500	hsa-miR-4422	PAR-CLIP	23592263
MIRT466499	hsa-miR-3646	PAR-CLIP	23592263
MIRT184195	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT184196	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT466498	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT466497	hsa-miR-3671	PAR-CLIP	23592263
MIRT466496	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT1416839	hsa-miR-101	CLIP-seq
MIRT1416840	hsa-miR-1225-5p	CLIP-seq
MIRT1416841	hsa-miR-124	CLIP-seq
MIRT1416842	hsa-miR-1245b-3p	CLIP-seq
MIRT1416843	hsa-miR-1248	CLIP-seq
MIRT1416844	hsa-miR-1258	CLIP-seq
MIRT1416845	hsa-miR-125b	CLIP-seq
MIRT1416846	hsa-miR-1297	CLIP-seq
MIRT1416847	hsa-miR-1299	CLIP-seq
MIRT1416848	hsa-miR-140-3p	CLIP-seq
MIRT1416849	hsa-miR-144	CLIP-seq
MIRT1416850	hsa-miR-150	CLIP-seq
MIRT1416851	hsa-miR-217	CLIP-seq
MIRT1416852	hsa-miR-26a	CLIP-seq
MIRT1416853	hsa-miR-26b	CLIP-seq
MIRT1416854	hsa-miR-29a	CLIP-seq
MIRT1416855	hsa-miR-29b	CLIP-seq
MIRT1416856	hsa-miR-29c	CLIP-seq
MIRT1416857	hsa-miR-3074-3p	CLIP-seq
MIRT1416858	hsa-miR-30a	CLIP-seq
MIRT1416859	hsa-miR-30b	CLIP-seq
MIRT1416860	hsa-miR-30c	CLIP-seq
MIRT1416861	hsa-miR-30d	CLIP-seq
MIRT1416862	hsa-miR-30e	CLIP-seq
MIRT1416863	hsa-miR-3148	CLIP-seq
MIRT1416864	hsa-miR-323-3p	CLIP-seq
MIRT1416865	hsa-miR-326	CLIP-seq
MIRT1416866	hsa-miR-330-3p	CLIP-seq
MIRT1416867	hsa-miR-330-5p	CLIP-seq
MIRT1416868	hsa-miR-331-5p	CLIP-seq
MIRT1416869	hsa-miR-3591-3p	CLIP-seq
MIRT1416870	hsa-miR-3609	CLIP-seq
MIRT1416871	hsa-miR-3661	CLIP-seq
MIRT1416872	hsa-miR-3667-3p	CLIP-seq
MIRT1416873	hsa-miR-3674	CLIP-seq
MIRT1416874	hsa-miR-3688-3p	CLIP-seq
MIRT1416875	hsa-miR-3688-5p	CLIP-seq
MIRT1416876	hsa-miR-377	CLIP-seq
MIRT1416877	hsa-miR-3941	CLIP-seq
MIRT1416878	hsa-miR-3942-5p	CLIP-seq
MIRT1416879	hsa-miR-4275	CLIP-seq
MIRT1416880	hsa-miR-4277	CLIP-seq
MIRT1416881	hsa-miR-4282	CLIP-seq
MIRT1416882	hsa-miR-4292	CLIP-seq
MIRT1416883	hsa-miR-4308	CLIP-seq
MIRT1416884	hsa-miR-4319	CLIP-seq
MIRT1416885	hsa-miR-4418	CLIP-seq
MIRT1416886	hsa-miR-4433	CLIP-seq
MIRT1416887	hsa-miR-4434	CLIP-seq
MIRT1416888	hsa-miR-4446-3p	CLIP-seq
MIRT1416889	hsa-miR-4459	CLIP-seq
MIRT1416890	hsa-miR-4465	CLIP-seq
MIRT1416891	hsa-miR-4468	CLIP-seq
MIRT1416892	hsa-miR-4470	CLIP-seq
MIRT1416893	hsa-miR-4481	CLIP-seq
MIRT1416894	hsa-miR-4490	CLIP-seq
MIRT1416895	hsa-miR-4495	CLIP-seq
MIRT1416896	hsa-miR-4496	CLIP-seq
MIRT1416897	hsa-miR-4516	CLIP-seq
MIRT1416898	hsa-miR-4531	CLIP-seq
MIRT1416899	hsa-miR-4645-3p	CLIP-seq
MIRT1416900	hsa-miR-4656	CLIP-seq
MIRT1416901	hsa-miR-466	CLIP-seq
MIRT1416902	hsa-miR-4663	CLIP-seq
MIRT1416903	hsa-miR-4666-5p	CLIP-seq
MIRT1416904	hsa-miR-4672	CLIP-seq
MIRT1416905	hsa-miR-4678	CLIP-seq
MIRT1416906	hsa-miR-4682	CLIP-seq
MIRT1416907	hsa-miR-4685-5p	CLIP-seq
MIRT1416908	hsa-miR-4699-3p	CLIP-seq
MIRT1416909	hsa-miR-4703-5p	CLIP-seq
MIRT1416910	hsa-miR-4708-3p	CLIP-seq
MIRT1416911	hsa-miR-4716-5p	CLIP-seq
MIRT1416912	hsa-miR-4719	CLIP-seq
MIRT1416913	hsa-miR-4722-3p	CLIP-seq
MIRT1416914	hsa-miR-4729	CLIP-seq
MIRT1416915	hsa-miR-4732-3p	CLIP-seq
MIRT1416916	hsa-miR-4745-5p	CLIP-seq
MIRT1416917	hsa-miR-4753-3p	CLIP-seq
MIRT1416918	hsa-miR-4758-5p	CLIP-seq
MIRT1416919	hsa-miR-4766-3p	CLIP-seq
MIRT1416920	hsa-miR-4768-3p	CLIP-seq
MIRT1416921	hsa-miR-4768-5p	CLIP-seq
MIRT1416922	hsa-miR-4782-5p	CLIP-seq
MIRT1416923	hsa-miR-4790-3p	CLIP-seq
MIRT1416924	hsa-miR-4795-3p	CLIP-seq
MIRT1416925	hsa-miR-4803	CLIP-seq
MIRT1416926	hsa-miR-499-3p	CLIP-seq
MIRT1416927	hsa-miR-499a-3p	CLIP-seq
MIRT1416928	hsa-miR-506	CLIP-seq
MIRT1416929	hsa-miR-509-3-5p	CLIP-seq
MIRT1416930	hsa-miR-509-5p	CLIP-seq
MIRT1416931	hsa-miR-513b	CLIP-seq
MIRT1416932	hsa-miR-513c	CLIP-seq
MIRT1416933	hsa-miR-514b-5p	CLIP-seq
MIRT1416934	hsa-miR-539	CLIP-seq
MIRT1416935	hsa-miR-548a-3p	CLIP-seq
MIRT1416936	hsa-miR-548ah	CLIP-seq
MIRT1416937	hsa-miR-548e	CLIP-seq
MIRT1416938	hsa-miR-548f	CLIP-seq
MIRT1416939	hsa-miR-548n	CLIP-seq
MIRT1416940	hsa-miR-548p	CLIP-seq
MIRT1416941	hsa-miR-548t	CLIP-seq
MIRT1416942	hsa-miR-549	CLIP-seq
MIRT1416943	hsa-miR-577	CLIP-seq
MIRT1416944	hsa-miR-583	CLIP-seq
MIRT1416945	hsa-miR-631	CLIP-seq
MIRT1416946	hsa-miR-653	CLIP-seq
MIRT1416947	hsa-miR-670	CLIP-seq
MIRT1416948	hsa-miR-760	CLIP-seq
MIRT1416949	hsa-miR-767-5p	CLIP-seq
MIRT1416950	hsa-miR-875-3p	CLIP-seq
MIRT1416951	hsa-miR-934	CLIP-seq
MIRT1416952	hsa-miR-935	CLIP-seq
MIRT1416953	hsa-miR-938	CLIP-seq
MIRT1416954	hsa-miR-944	CLIP-seq
MIRT1416839	hsa-miR-101	CLIP-seq
MIRT2125028	hsa-miR-103b	CLIP-seq
MIRT1416840	hsa-miR-1225-5p	CLIP-seq
MIRT2125029	hsa-miR-1251	CLIP-seq
MIRT1416844	hsa-miR-1258	CLIP-seq
MIRT1416845	hsa-miR-125b	CLIP-seq
MIRT2125030	hsa-miR-1275	CLIP-seq
MIRT2125031	hsa-miR-1343	CLIP-seq
MIRT1416848	hsa-miR-140-3p	CLIP-seq
MIRT1416849	hsa-miR-144	CLIP-seq
MIRT2125032	hsa-miR-183	CLIP-seq
MIRT1416851	hsa-miR-217	CLIP-seq
MIRT1416854	hsa-miR-29a	CLIP-seq
MIRT1416855	hsa-miR-29b	CLIP-seq
MIRT1416856	hsa-miR-29c	CLIP-seq
MIRT1416858	hsa-miR-30a	CLIP-seq
MIRT1416859	hsa-miR-30b	CLIP-seq
MIRT1416860	hsa-miR-30c	CLIP-seq
MIRT1416861	hsa-miR-30d	CLIP-seq
MIRT1416862	hsa-miR-30e	CLIP-seq
MIRT1416863	hsa-miR-3148	CLIP-seq
MIRT2125033	hsa-miR-3150a-5p	CLIP-seq
MIRT2125034	hsa-miR-3150b-5p	CLIP-seq
MIRT2125035	hsa-miR-3175	CLIP-seq
MIRT1416864	hsa-miR-323-3p	CLIP-seq
MIRT2125036	hsa-miR-34c-3p	CLIP-seq
MIRT1416873	hsa-miR-3674	CLIP-seq
MIRT2125037	hsa-miR-3681	CLIP-seq
MIRT1416874	hsa-miR-3688-3p	CLIP-seq
MIRT1416876	hsa-miR-377	CLIP-seq
MIRT1416877	hsa-miR-3941	CLIP-seq
MIRT2125038	hsa-miR-410	CLIP-seq
MIRT1416879	hsa-miR-4275	CLIP-seq
MIRT1416882	hsa-miR-4292	CLIP-seq
MIRT1416883	hsa-miR-4308	CLIP-seq
MIRT1416884	hsa-miR-4319	CLIP-seq
MIRT2125039	hsa-miR-4447	CLIP-seq
MIRT2125040	hsa-miR-4472	CLIP-seq
MIRT1416895	hsa-miR-4495	CLIP-seq
MIRT1416896	hsa-miR-4496	CLIP-seq
MIRT2125041	hsa-miR-4525	CLIP-seq
MIRT2125042	hsa-miR-4651	CLIP-seq
MIRT2125043	hsa-miR-4659a-3p	CLIP-seq
MIRT2125044	hsa-miR-4659b-3p	CLIP-seq
MIRT1416901	hsa-miR-466	CLIP-seq
MIRT2125045	hsa-miR-4665-5p	CLIP-seq
MIRT1416904	hsa-miR-4672	CLIP-seq
MIRT1416910	hsa-miR-4708-3p	CLIP-seq
MIRT1416911	hsa-miR-4716-5p	CLIP-seq
MIRT2125046	hsa-miR-4723-5p	CLIP-seq
MIRT1416914	hsa-miR-4729	CLIP-seq
MIRT1416919	hsa-miR-4766-3p	CLIP-seq
MIRT1416925	hsa-miR-4803	CLIP-seq
MIRT2125047	hsa-miR-485-3p	CLIP-seq
MIRT1416926	hsa-miR-499-3p	CLIP-seq
MIRT1416927	hsa-miR-499a-3p	CLIP-seq
MIRT1416931	hsa-miR-513b	CLIP-seq
MIRT2125048	hsa-miR-548ac	CLIP-seq
MIRT2125049	hsa-miR-548d-3p	CLIP-seq
MIRT1416940	hsa-miR-548p	CLIP-seq
MIRT2125050	hsa-miR-548z	CLIP-seq
MIRT2125051	hsa-miR-587	CLIP-seq
MIRT2125052	hsa-miR-606	CLIP-seq
MIRT2125053	hsa-miR-608	CLIP-seq
MIRT2125054	hsa-miR-625	CLIP-seq
MIRT2125055	hsa-miR-637	CLIP-seq
MIRT1416949	hsa-miR-767-5p	CLIP-seq
MIRT2125056	hsa-miR-769-5p	CLIP-seq
MIRT2125057	hsa-miR-889	CLIP-seq
MIRT1416952	hsa-miR-935	CLIP-seq
MIRT1416839	hsa-miR-101	CLIP-seq
MIRT2125028	hsa-miR-103b	CLIP-seq
MIRT1416840	hsa-miR-1225-5p	CLIP-seq
MIRT1416842	hsa-miR-1245b-3p	CLIP-seq
MIRT1416845	hsa-miR-125b	CLIP-seq
MIRT2125030	hsa-miR-1275	CLIP-seq
MIRT2347468	hsa-miR-1279	CLIP-seq
MIRT1416846	hsa-miR-1297	CLIP-seq
MIRT2125031	hsa-miR-1343	CLIP-seq
MIRT1416849	hsa-miR-144	CLIP-seq
MIRT2125032	hsa-miR-183	CLIP-seq
MIRT2347469	hsa-miR-216b	CLIP-seq
MIRT1416851	hsa-miR-217	CLIP-seq
MIRT1416852	hsa-miR-26a	CLIP-seq
MIRT1416853	hsa-miR-26b	CLIP-seq
MIRT1416857	hsa-miR-3074-3p	CLIP-seq
MIRT1416858	hsa-miR-30a	CLIP-seq
MIRT1416859	hsa-miR-30b	CLIP-seq
MIRT1416860	hsa-miR-30c	CLIP-seq
MIRT1416861	hsa-miR-30d	CLIP-seq
MIRT1416862	hsa-miR-30e	CLIP-seq
MIRT1416863	hsa-miR-3148	CLIP-seq
MIRT2125033	hsa-miR-3150a-5p	CLIP-seq
MIRT2125034	hsa-miR-3150b-5p	CLIP-seq
MIRT2347470	hsa-miR-320a	CLIP-seq
MIRT2347471	hsa-miR-320b	CLIP-seq
MIRT2347472	hsa-miR-320c	CLIP-seq
MIRT2347473	hsa-miR-320d	CLIP-seq
MIRT1416866	hsa-miR-330-3p	CLIP-seq
MIRT2347474	hsa-miR-338-5p	CLIP-seq
MIRT2347475	hsa-miR-342-3p	CLIP-seq
MIRT2125036	hsa-miR-34c-3p	CLIP-seq
MIRT1416874	hsa-miR-3688-3p	CLIP-seq
MIRT1416875	hsa-miR-3688-5p	CLIP-seq
MIRT2125038	hsa-miR-410	CLIP-seq
MIRT1416882	hsa-miR-4292	CLIP-seq
MIRT1416883	hsa-miR-4308	CLIP-seq
MIRT1416884	hsa-miR-4319	CLIP-seq
MIRT2347476	hsa-miR-4429	CLIP-seq
MIRT1416886	hsa-miR-4433	CLIP-seq
MIRT2125039	hsa-miR-4447	CLIP-seq
MIRT1416889	hsa-miR-4459	CLIP-seq
MIRT1416890	hsa-miR-4465	CLIP-seq
MIRT1416892	hsa-miR-4470	CLIP-seq
MIRT2125040	hsa-miR-4472	CLIP-seq
MIRT1416893	hsa-miR-4481	CLIP-seq
MIRT1416895	hsa-miR-4495	CLIP-seq
MIRT2125041	hsa-miR-4525	CLIP-seq
MIRT2125042	hsa-miR-4651	CLIP-seq
MIRT2125045	hsa-miR-4665-5p	CLIP-seq
MIRT1416903	hsa-miR-4666-5p	CLIP-seq
MIRT1416908	hsa-miR-4699-3p	CLIP-seq
MIRT2347477	hsa-miR-4714-3p	CLIP-seq
MIRT1416911	hsa-miR-4716-5p	CLIP-seq
MIRT1416912	hsa-miR-4719	CLIP-seq
MIRT2125046	hsa-miR-4723-5p	CLIP-seq
MIRT1416914	hsa-miR-4729	CLIP-seq
MIRT1416916	hsa-miR-4745-5p	CLIP-seq
MIRT1416918	hsa-miR-4758-5p	CLIP-seq
MIRT1416920	hsa-miR-4768-3p	CLIP-seq
MIRT2347478	hsa-miR-4775	CLIP-seq
MIRT2347479	hsa-miR-4789-5p	CLIP-seq
MIRT1416924	hsa-miR-4795-3p	CLIP-seq
MIRT1416925	hsa-miR-4803	CLIP-seq
MIRT1416926	hsa-miR-499-3p	CLIP-seq
MIRT1416927	hsa-miR-499a-3p	CLIP-seq
MIRT1416931	hsa-miR-513b	CLIP-seq
MIRT1416932	hsa-miR-513c	CLIP-seq
MIRT1416933	hsa-miR-514b-5p	CLIP-seq
MIRT1416935	hsa-miR-548a-3p	CLIP-seq
MIRT1416937	hsa-miR-548e	CLIP-seq
MIRT1416938	hsa-miR-548f	CLIP-seq
MIRT2347480	hsa-miR-548m	CLIP-seq
MIRT1416942	hsa-miR-549	CLIP-seq
MIRT1416943	hsa-miR-577	CLIP-seq
MIRT2347481	hsa-miR-579	CLIP-seq
MIRT2125051	hsa-miR-587	CLIP-seq
MIRT2125053	hsa-miR-608	CLIP-seq
MIRT2125054	hsa-miR-625	CLIP-seq
MIRT2125055	hsa-miR-637	CLIP-seq
MIRT2347482	hsa-miR-643	CLIP-seq
MIRT1416946	hsa-miR-653	CLIP-seq
MIRT2347483	hsa-miR-656	CLIP-seq
MIRT1416949	hsa-miR-767-5p	CLIP-seq
MIRT2125057	hsa-miR-889	CLIP-seq
MIRT1416839	hsa-miR-101	CLIP-seq
MIRT2395628	hsa-miR-1253	CLIP-seq
MIRT2125030	hsa-miR-1275	CLIP-seq
MIRT2125031	hsa-miR-1343	CLIP-seq
MIRT1416849	hsa-miR-144	CLIP-seq
MIRT1416858	hsa-miR-30a	CLIP-seq
MIRT1416859	hsa-miR-30b	CLIP-seq
MIRT1416860	hsa-miR-30c	CLIP-seq
MIRT1416861	hsa-miR-30d	CLIP-seq
MIRT1416862	hsa-miR-30e	CLIP-seq
MIRT2125033	hsa-miR-3150a-5p	CLIP-seq
MIRT2125034	hsa-miR-3150b-5p	CLIP-seq
MIRT2125035	hsa-miR-3175	CLIP-seq
MIRT2125038	hsa-miR-410	CLIP-seq
MIRT2125039	hsa-miR-4447	CLIP-seq
MIRT2125040	hsa-miR-4472	CLIP-seq
MIRT1416895	hsa-miR-4495	CLIP-seq
MIRT2125041	hsa-miR-4525	CLIP-seq
MIRT2125042	hsa-miR-4651	CLIP-seq
MIRT2125045	hsa-miR-4665-5p	CLIP-seq
MIRT1416911	hsa-miR-4716-5p	CLIP-seq
MIRT2125046	hsa-miR-4723-5p	CLIP-seq
MIRT1416914	hsa-miR-4729	CLIP-seq
MIRT1416926	hsa-miR-499-3p	CLIP-seq
MIRT1416927	hsa-miR-499a-3p	CLIP-seq
MIRT1416944	hsa-miR-583	CLIP-seq
MIRT2125053	hsa-miR-608	CLIP-seq
MIRT2125054	hsa-miR-625	CLIP-seq
MIRT2125055	hsa-miR-637	CLIP-seq
MIRT2125056	hsa-miR-769-5p	CLIP-seq
MIRT1416840	hsa-miR-1225-5p	CLIP-seq
MIRT1416864	hsa-miR-323-3p	CLIP-seq
MIRT1416882	hsa-miR-4292	CLIP-seq
MIRT1416883	hsa-miR-4308	CLIP-seq
MIRT1416899	hsa-miR-4645-3p	CLIP-seq
MIRT2125043	hsa-miR-4659a-3p	CLIP-seq
MIRT2125044	hsa-miR-4659b-3p	CLIP-seq
MIRT1416954	hsa-miR-944	CLIP-seq
MIRT1416845	hsa-miR-125b	CLIP-seq
MIRT2435121	hsa-miR-302f	CLIP-seq
MIRT2435122	hsa-miR-4268	CLIP-seq
MIRT1416884	hsa-miR-4319	CLIP-seq
MIRT2435123	hsa-miR-4448	CLIP-seq
MIRT1416866	hsa-miR-330-3p	CLIP-seq
MIRT1416888	hsa-miR-4446-3p	CLIP-seq
MIRT1416891	hsa-miR-4468	CLIP-seq
MIRT1416900	hsa-miR-4656	CLIP-seq
MIRT1416902	hsa-miR-4663	CLIP-seq
MIRT1416907	hsa-miR-4685-5p	CLIP-seq
MIRT1416948	hsa-miR-760	CLIP-seq
MIRT2640400	hsa-miR-103a	CLIP-seq
MIRT2640401	hsa-miR-107	CLIP-seq
MIRT2640402	hsa-miR-1184	CLIP-seq
MIRT1416840	hsa-miR-1225-5p	CLIP-seq
MIRT2640403	hsa-miR-1244	CLIP-seq
MIRT1416843	hsa-miR-1248	CLIP-seq
MIRT2640404	hsa-miR-1912	CLIP-seq
MIRT1416851	hsa-miR-217	CLIP-seq
MIRT2640405	hsa-miR-28-3p	CLIP-seq
MIRT1416854	hsa-miR-29a	CLIP-seq
MIRT1416855	hsa-miR-29b	CLIP-seq
MIRT1416856	hsa-miR-29c	CLIP-seq
MIRT2640406	hsa-miR-3125	CLIP-seq
MIRT2640407	hsa-miR-3130-5p	CLIP-seq
MIRT2640408	hsa-miR-3143	CLIP-seq
MIRT1416863	hsa-miR-3148	CLIP-seq
MIRT2640409	hsa-miR-3163	CLIP-seq
MIRT1416866	hsa-miR-330-3p	CLIP-seq
MIRT1416868	hsa-miR-331-5p	CLIP-seq
MIRT2640410	hsa-miR-3605-5p	CLIP-seq
MIRT1416871	hsa-miR-3661	CLIP-seq
MIRT1416873	hsa-miR-3674	CLIP-seq
MIRT1416874	hsa-miR-3688-3p	CLIP-seq
MIRT2640411	hsa-miR-3916	CLIP-seq
MIRT1416882	hsa-miR-4292	CLIP-seq
MIRT1416883	hsa-miR-4308	CLIP-seq
MIRT2640412	hsa-miR-4310	CLIP-seq
MIRT2640413	hsa-miR-4328	CLIP-seq
MIRT1416885	hsa-miR-4418	CLIP-seq
MIRT1416886	hsa-miR-4433	CLIP-seq
MIRT1416888	hsa-miR-4446-3p	CLIP-seq
MIRT1416889	hsa-miR-4459	CLIP-seq
MIRT2640414	hsa-miR-4464	CLIP-seq
MIRT1416891	hsa-miR-4468	CLIP-seq
MIRT2640415	hsa-miR-4482	CLIP-seq
MIRT2640416	hsa-miR-4640-5p	CLIP-seq
MIRT1416899	hsa-miR-4645-3p	CLIP-seq
MIRT1416900	hsa-miR-4656	CLIP-seq
MIRT2125043	hsa-miR-4659a-3p	CLIP-seq
MIRT2125044	hsa-miR-4659b-3p	CLIP-seq
MIRT1416902	hsa-miR-4663	CLIP-seq
MIRT1416905	hsa-miR-4678	CLIP-seq
MIRT1416907	hsa-miR-4685-5p	CLIP-seq
MIRT2347477	hsa-miR-4714-3p	CLIP-seq
MIRT2640417	hsa-miR-4715-3p	CLIP-seq
MIRT1416912	hsa-miR-4719	CLIP-seq
MIRT2640418	hsa-miR-4726-5p	CLIP-seq
MIRT2640419	hsa-miR-4748	CLIP-seq
MIRT1416920	hsa-miR-4768-3p	CLIP-seq
MIRT1416922	hsa-miR-4782-5p	CLIP-seq
MIRT2347479	hsa-miR-4789-5p	CLIP-seq
MIRT2640420	hsa-miR-491-3p	CLIP-seq
MIRT1416929	hsa-miR-509-3-5p	CLIP-seq
MIRT1416930	hsa-miR-509-5p	CLIP-seq
MIRT2640421	hsa-miR-543	CLIP-seq
MIRT1416935	hsa-miR-548a-3p	CLIP-seq
MIRT1416937	hsa-miR-548e	CLIP-seq
MIRT1416938	hsa-miR-548f	CLIP-seq
MIRT2347480	hsa-miR-548m	CLIP-seq
MIRT1416942	hsa-miR-549	CLIP-seq
MIRT2125051	hsa-miR-587	CLIP-seq
MIRT1416945	hsa-miR-631	CLIP-seq
MIRT1416948	hsa-miR-760	CLIP-seq
MIRT1416949	hsa-miR-767-5p	CLIP-seq
MIRT2640422	hsa-miR-877	CLIP-seq
MIRT2125057	hsa-miR-889	CLIP-seq
MIRT1416953	hsa-miR-938	CLIP-seq
MIRT1416954	hsa-miR-944	CLIP-seq
MIRT2640400	hsa-miR-103a	CLIP-seq
MIRT2640401	hsa-miR-107	CLIP-seq
MIRT2640402	hsa-miR-1184	CLIP-seq
MIRT1416840	hsa-miR-1225-5p	CLIP-seq
MIRT2640403	hsa-miR-1244	CLIP-seq
MIRT1416843	hsa-miR-1248	CLIP-seq
MIRT2640404	hsa-miR-1912	CLIP-seq
MIRT1416851	hsa-miR-217	CLIP-seq
MIRT1416854	hsa-miR-29a	CLIP-seq
MIRT1416855	hsa-miR-29b	CLIP-seq
MIRT1416856	hsa-miR-29c	CLIP-seq
MIRT2692856	hsa-miR-300	CLIP-seq
MIRT2640407	hsa-miR-3130-5p	CLIP-seq
MIRT2640408	hsa-miR-3143	CLIP-seq
MIRT1416863	hsa-miR-3148	CLIP-seq
MIRT2640409	hsa-miR-3163	CLIP-seq
MIRT1416866	hsa-miR-330-3p	CLIP-seq
MIRT1416868	hsa-miR-331-5p	CLIP-seq
MIRT2640410	hsa-miR-3605-5p	CLIP-seq
MIRT1416871	hsa-miR-3661	CLIP-seq
MIRT1416873	hsa-miR-3674	CLIP-seq
MIRT1416874	hsa-miR-3688-3p	CLIP-seq
MIRT2692857	hsa-miR-381	CLIP-seq
MIRT1416882	hsa-miR-4292	CLIP-seq
MIRT1416883	hsa-miR-4308	CLIP-seq
MIRT2640412	hsa-miR-4310	CLIP-seq
MIRT2640413	hsa-miR-4328	CLIP-seq
MIRT1416885	hsa-miR-4418	CLIP-seq
MIRT1416888	hsa-miR-4446-3p	CLIP-seq
MIRT1416891	hsa-miR-4468	CLIP-seq
MIRT2640415	hsa-miR-4482	CLIP-seq
MIRT2692858	hsa-miR-4503	CLIP-seq
MIRT2640416	hsa-miR-4640-5p	CLIP-seq
MIRT1416899	hsa-miR-4645-3p	CLIP-seq
MIRT1416900	hsa-miR-4656	CLIP-seq
MIRT1416902	hsa-miR-4663	CLIP-seq
MIRT2692859	hsa-miR-4666-3p	CLIP-seq
MIRT1416905	hsa-miR-4678	CLIP-seq
MIRT1416907	hsa-miR-4685-5p	CLIP-seq
MIRT2640417	hsa-miR-4715-3p	CLIP-seq
MIRT1416912	hsa-miR-4719	CLIP-seq
MIRT2640418	hsa-miR-4726-5p	CLIP-seq
MIRT1416922	hsa-miR-4782-5p	CLIP-seq
MIRT2347479	hsa-miR-4789-5p	CLIP-seq
MIRT1416929	hsa-miR-509-3-5p	CLIP-seq
MIRT1416930	hsa-miR-509-5p	CLIP-seq
MIRT2640421	hsa-miR-543	CLIP-seq
MIRT1416935	hsa-miR-548a-3p	CLIP-seq
MIRT2692860	hsa-miR-548c-3p	CLIP-seq
MIRT1416937	hsa-miR-548e	CLIP-seq
MIRT1416938	hsa-miR-548f	CLIP-seq
MIRT2347480	hsa-miR-548m	CLIP-seq
MIRT1416942	hsa-miR-549	CLIP-seq
MIRT1416945	hsa-miR-631	CLIP-seq
MIRT1416948	hsa-miR-760	CLIP-seq
MIRT1416949	hsa-miR-767-5p	CLIP-seq
MIRT2125057	hsa-miR-889	CLIP-seq
MIRT1416953	hsa-miR-938	CLIP-seq
MIRT1416954	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DNMT3L	Repression	20428781

Gene ontology (GO) Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000287	Function	Magnesium ion binding	IDA	15959518
GO:0000700	Function	Mismatch base pair DNA N-glycosylase activity	IEA
GO:0003676	Function	Nucleic acid binding	EXP	18512959
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003684	Function	Damaged DNA binding	TAS	9489705
GO:0003690	Function	Double-stranded DNA binding	IDA	11889051, 18512959, 22327402
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0004844	Function	Uracil DNA N-glycosylase activity	IBA
GO:0004844	Function	Uracil DNA N-glycosylase activity	IDA	11889051
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005515	Function	Protein binding	IPI	15959518, 16282588, 16626738, 16763556, 20696907, 21722948, 22327402, 32814053
GO:0005524	Function	ATP binding	IDA	11889051
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8662714, 11889051
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS	9489705
GO:0005886	Component	Plasma membrane	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IDA	21862836, 22327402, 22573813
GO:0006284	Process	Base-excision repair	IEA
GO:0006284	Process	Base-excision repair	TAS	9489705
GO:0006285	Process	Base-excision repair, AP site formation	IBA
GO:0006285	Process	Base-excision repair, AP site formation	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008263	Function	Pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IBA
GO:0008263	Function	Pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IDA	8662714, 11889051, 22573813
GO:0008263	Function	Pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IMP	18512959
GO:0016605	Component	PML body	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	IDA	21862836, 22327402
GO:0019104	Function	DNA N-glycosylase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	IMP	18512959
GO:0019104	Function	DNA N-glycosylase activity	TAS
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030983	Function	Mismatched DNA binding	IDA	11889051, 15959518, 16626738, 18512959, 22573813
GO:0031402	Function	Sodium ion binding	IDA	15959518
GO:0031404	Function	Chloride ion binding	IDA	15959518
GO:0032183	Function	SUMO binding	IEA
GO:0032183	Function	SUMO binding	IPI	15959518
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	ISS
GO:0043739	Function	G/U mismatch-specific uracil-DNA glycosylase activity	IMP	18512959
GO:0045008	Process	Depyrimidination	TAS
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0141016	Function	G/T mismatch-specific thymine-DNA glycosylase activity	IEA
GO:0141167	Process	Chromosomal 5-methylcytosine DNA demethylation, oxidation pathway	TAS

Other IDs

• MIM: 601423
• HGNC: 11700
• e!Ensembl: ENSG00000139372

Protein

• UniProt ID: Q13569
• Protein name: G/T mismatch-specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine-DNA glycosylase) (hTDG)
• Protein function: DNA glycosylase that plays a key role in active DNA demethylation: specifically recognizes and binds 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) in the context of CpG sites and mediates their excision through base-excision repair (BER)
• PDB: 1WYW , 2D07 , 2RBA , 3UFJ , 3UO7 , 3UOB , 4FNC , 4JGC , 4XEG , 4Z3A , 4Z47 , 4Z7B , 4Z7Z , 5CYS , 5FF8 , 5HF7 , 5JXY , 5T2W , 6U15 , 6U16 , 6U17
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03167	UDG	125 → 295	Uracil DNA glycosylase superfamily	Domain

• Sequence:

  MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKG
  RKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELL
  TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT
  LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK
  EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK
  GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSS
  NGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

• Sequence length: 410

Pathways

KEGG Pathway	Reactome Pathway
Base excision repair	Recognition and association of DNA glycosylase with site containing an affected pyrimidine
	Cleavage of the damaged pyrimidine
	Displacement of DNA glycosylase by APEX1
	SUMOylation of DNA damage response and repair proteins
	TET1,2,3 and TDG demethylate DNA

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (35)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25945745	Associate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28228863		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29378668		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26207381	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37224078	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28228863		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22961839, 24748645		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17029639, 24532795, 31239841		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17029639, 24532795, 36811212	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17029639		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	28228863		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23504502, 25431829	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30705090		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15225156		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36748375	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29378668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26544625		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31141850		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25098926, 9230216		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30926028, 9230216		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22961839, 24748645		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28228863		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30674989		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17965616	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17965616		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30861523		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22608206, 9230216		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26544625		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22608206		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	22581838	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25098926, 9230216		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23504502	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28848075	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35379200	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	LHGDN	12505994		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SMUG1 4 shared pathwaysBase excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine, Cleavage of the damaged pyrimidine , Displacement of DNA glycosylase by APEX1 Related via 4 shared pathways including Base excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine. MBD4 4 shared pathwaysBase excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine, Cleavage of the damaged pyrimidine , Displacement of DNA glycosylase by APEX1 Related via 4 shared pathways including Base excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine. UNG 4 shared pathwaysBase excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine, Cleavage of the damaged pyrimidine , Displacement of DNA glycosylase by APEX1 Related via 4 shared pathways including Base excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine. NTHL1 4 shared pathwaysBase excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine, Cleavage of the damaged pyrimidine , Displacement of DNA glycosylase by APEX1 Related via 4 shared pathways including Base excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine. NEIL2 3 shared pathwaysBase excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine, Cleavage of the damaged pyrimidine Related via 3 shared pathways including Base excision repair, Recognition and association of DNA glycosylase with site containing an affected pyrimidine.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SMUG1	0	[]	4	["Base excision repair","Recognition and association of DNA glycosylase with site containing an affected pyrimidine","Cleavage of the damaged pyrimidine ","Displacement of DNA glycosylase by APEX1"]	0	[]
MBD4	0	[]	4	["Base excision repair","Recognition and association of DNA glycosylase with site containing an affected pyrimidine","Cleavage of the damaged pyrimidine ","Displacement of DNA glycosylase by APEX1"]	0	[]
UNG	0	[]	4	["Base excision repair","Recognition and association of DNA glycosylase with site containing an affected pyrimidine","Cleavage of the damaged pyrimidine ","Displacement of DNA glycosylase by APEX1"]	0	[]
NTHL1	0	[]	4	["Base excision repair","Recognition and association of DNA glycosylase with site containing an affected pyrimidine","Cleavage of the damaged pyrimidine ","Displacement of DNA glycosylase by APEX1"]	0	[]
NEIL2	0	[]	3	["Base excision repair","Recognition and association of DNA glycosylase with site containing an affected pyrimidine","Cleavage of the damaged pyrimidine "]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 2 of 5 related genesSMUG1, UNG Coronary artery disease Linked via 1 of 5 related genesSMUG1 Myocardial infarction Linked via 1 of 5 related genesSMUG1 Scoliosis Linked via 1 of 5 related genesSMUG1 Diabetes mellitus type 2 Linked via 1 of 5 related genesSMUG1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	2	["SMUG1","UNG"]
Coronary artery disease	1	["SMUG1"]
Myocardial infarction	1	["SMUG1"]
Scoliosis	1	["SMUG1"]
Diabetes mellitus type 2	1	["SMUG1"]