TCF7L2 (transcription factor 7 like 2)

Gene

• Entrez ID: 6934
• Gene name: Transcription factor 7 like 2
• Gene symbol: TCF7L2
• Synonyms (NCBI Gene): TCF-4, TCF4
• Chromosome: 10
• Chromosome location: 10q25.2-q25.3
• Summary: This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs7903146	C>G,T	Drug-response, risk-factor	Intron variant, genic upstream transcript variant
rs11196205	G>A,C,T	Risk-factor	Intron variant, genic upstream transcript variant
rs12255372	G>A,T	Risk-factor	Intron variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043583	hsa-miR-148b-3p	CLASH	23622248
MIRT043052	hsa-miR-324-5p	CLASH	23622248
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT641843	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641842	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT641841	hsa-miR-6768-3p	HITS-CLIP	23824327
MIRT641840	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT641839	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT641838	hsa-miR-3938	HITS-CLIP	23824327
MIRT641837	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT641836	hsa-miR-623	HITS-CLIP	23824327
MIRT641835	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT641834	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT261341	hsa-miR-8063	HITS-CLIP	23824327
MIRT261338	hsa-miR-4698	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT621861	hsa-miR-8485	HITS-CLIP	23824327
MIRT621860	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT621859	hsa-miR-421	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT261349	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT261342	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT261347	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT553717	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT553716	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT553715	hsa-miR-4295	PAR-CLIP	21572407
MIRT553714	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT553713	hsa-miR-3666	PAR-CLIP	21572407
MIRT553712	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT553711	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT553710	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT553709	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT553708	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT553707	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT553706	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT553705	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT553704	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT553703	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT553702	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT553701	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT553700	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT553698	hsa-miR-4759	PAR-CLIP	21572407
MIRT553699	hsa-miR-3169	PAR-CLIP	21572407
MIRT553697	hsa-miR-8083	PAR-CLIP	21572407
MIRT261354	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT553696	hsa-miR-5193	PAR-CLIP	21572407
MIRT553695	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT553694	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT553693	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT553692	hsa-miR-891b	PAR-CLIP	21572407
MIRT553691	hsa-miR-3117-3p	PAR-CLIP	21572407
MIRT553690	hsa-miR-651-5p	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	21572407
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	21572407
MIRT505428	hsa-miR-429	PAR-CLIP	21572407
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT505425	hsa-miR-1-5p	PAR-CLIP	21572407
MIRT505424	hsa-miR-4418	PAR-CLIP	21572407
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT505422	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT505421	hsa-miR-217	PAR-CLIP	21572407
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT505419	hsa-miR-892b	PAR-CLIP	21572407
MIRT505418	hsa-miR-3919	PAR-CLIP	21572407
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT505415	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT505414	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT505413	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	21572407
MIRT505411	hsa-miR-4435	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	23446348
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	23446348
MIRT505428	hsa-miR-429	PAR-CLIP	23446348
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	23446348
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	23446348
MIRT505425	hsa-miR-1-5p	PAR-CLIP	23446348
MIRT505424	hsa-miR-4418	PAR-CLIP	23446348
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT505422	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT505421	hsa-miR-217	PAR-CLIP	23446348
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	23446348
MIRT505419	hsa-miR-892b	PAR-CLIP	23446348
MIRT505418	hsa-miR-3919	PAR-CLIP	23446348
MIRT505417	hsa-miR-4793-3p	PAR-CLIP	23446348
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT505415	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT505414	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT505413	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	23446348
MIRT505411	hsa-miR-4435	PAR-CLIP	23446348
MIRT736693	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, Immunofluorescence	32579400
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT641843	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641842	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT641841	hsa-miR-6768-3p	HITS-CLIP	23824327
MIRT641840	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT641839	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT641838	hsa-miR-3938	HITS-CLIP	23824327
MIRT641837	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT641836	hsa-miR-623	HITS-CLIP	23824327
MIRT641835	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT641834	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT261341	hsa-miR-8063	HITS-CLIP	23824327
MIRT261338	hsa-miR-4698	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT621862	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT621861	hsa-miR-8485	HITS-CLIP	23824327
MIRT621860	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT621859	hsa-miR-421	HITS-CLIP	23824327
MIRT621858	hsa-miR-1305	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT261349	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT261342	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT261347	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT612391	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT612390	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT612389	hsa-miR-3685	HITS-CLIP	23824327
MIRT612388	hsa-miR-384	HITS-CLIP	23824327
MIRT553717	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT553716	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT553715	hsa-miR-4295	PAR-CLIP	21572407
MIRT553714	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT553713	hsa-miR-3666	PAR-CLIP	21572407
MIRT553712	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT553711	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT553710	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT553709	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT553708	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT553707	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT553706	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT553705	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT553704	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT553703	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT553702	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT553701	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT553700	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT553698	hsa-miR-4759	PAR-CLIP	21572407
MIRT553699	hsa-miR-3169	PAR-CLIP	21572407
MIRT553697	hsa-miR-8083	PAR-CLIP	21572407
MIRT261354	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT553696	hsa-miR-5193	PAR-CLIP	21572407
MIRT553695	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT553694	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT553693	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT553692	hsa-miR-891b	PAR-CLIP	21572407
MIRT553691	hsa-miR-3117-3p	PAR-CLIP	21572407
MIRT553690	hsa-miR-651-5p	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	21572407
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	21572407
MIRT505428	hsa-miR-429	PAR-CLIP	21572407
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT505425	hsa-miR-1-5p	PAR-CLIP	21572407
MIRT505424	hsa-miR-4418	PAR-CLIP	21572407
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT505422	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT505421	hsa-miR-217	PAR-CLIP	21572407
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	21572407
MIRT505419	hsa-miR-892b	PAR-CLIP	21572407
MIRT505418	hsa-miR-3919	PAR-CLIP	21572407
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT505415	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT505414	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT505413	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	21572407
MIRT505411	hsa-miR-4435	PAR-CLIP	21572407
MIRT505430	hsa-miR-200b-3p	PAR-CLIP	23446348
MIRT505429	hsa-miR-200c-3p	PAR-CLIP	23446348
MIRT505428	hsa-miR-429	PAR-CLIP	23446348
MIRT505427	hsa-miR-193b-3p	PAR-CLIP	23446348
MIRT505426	hsa-miR-193a-3p	PAR-CLIP	23446348
MIRT505425	hsa-miR-1-5p	PAR-CLIP	23446348
MIRT505424	hsa-miR-4418	PAR-CLIP	23446348
MIRT505423	hsa-miR-509-3-5p	PAR-CLIP	23446348
MIRT505422	hsa-miR-509-5p	PAR-CLIP	23446348
MIRT505421	hsa-miR-217	PAR-CLIP	23446348
MIRT505420	hsa-miR-6807-3p	PAR-CLIP	23446348
MIRT505419	hsa-miR-892b	PAR-CLIP	23446348
MIRT505418	hsa-miR-3919	PAR-CLIP	23446348
MIRT505417	hsa-miR-4793-3p	PAR-CLIP	23446348
MIRT505416	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT505415	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT505414	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT505413	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT505412	hsa-miR-1298-5p	PAR-CLIP	23446348
MIRT505411	hsa-miR-4435	PAR-CLIP	23446348
MIRT756266	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38372101
MIRT1416457	hsa-miR-1264	CLIP-seq
MIRT1416458	hsa-miR-1271	CLIP-seq
MIRT1416459	hsa-miR-1272	CLIP-seq
MIRT1416460	hsa-miR-1297	CLIP-seq
MIRT1416461	hsa-miR-182	CLIP-seq
MIRT1416462	hsa-miR-193b	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT1416464	hsa-miR-216b	CLIP-seq
MIRT1416465	hsa-miR-26a	CLIP-seq
MIRT1416466	hsa-miR-26b	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416468	hsa-miR-3136-3p	CLIP-seq
MIRT1416469	hsa-miR-3675-3p	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT1416471	hsa-miR-3942-5p	CLIP-seq
MIRT1416472	hsa-miR-4251	CLIP-seq
MIRT1416473	hsa-miR-4420	CLIP-seq
MIRT1416474	hsa-miR-4422	CLIP-seq
MIRT1416475	hsa-miR-4465	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT1416477	hsa-miR-4509	CLIP-seq
MIRT1416478	hsa-miR-4703-5p	CLIP-seq
MIRT1416479	hsa-miR-4744	CLIP-seq
MIRT1416480	hsa-miR-498	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416485	hsa-miR-561	CLIP-seq
MIRT1416486	hsa-miR-564	CLIP-seq
MIRT1416487	hsa-miR-580	CLIP-seq
MIRT1416488	hsa-miR-642a	CLIP-seq
MIRT1416489	hsa-miR-96	CLIP-seq
MIRT1416490	hsa-miR-1237	CLIP-seq
MIRT1416491	hsa-miR-1248	CLIP-seq
MIRT1416492	hsa-miR-1283	CLIP-seq
MIRT1416493	hsa-miR-1299	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT1416495	hsa-miR-2054	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416496	hsa-miR-3686	CLIP-seq
MIRT1416497	hsa-miR-369-3p	CLIP-seq
MIRT1416498	hsa-miR-374c	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT1416500	hsa-miR-450b-5p	CLIP-seq
MIRT1416501	hsa-miR-4517	CLIP-seq
MIRT1416502	hsa-miR-4636	CLIP-seq
MIRT1416503	hsa-miR-4652-3p	CLIP-seq
MIRT1416504	hsa-miR-4721	CLIP-seq
MIRT1416505	hsa-miR-4782-5p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416507	hsa-miR-505	CLIP-seq
MIRT1416508	hsa-miR-507	CLIP-seq
MIRT1416509	hsa-miR-516b	CLIP-seq
MIRT1416510	hsa-miR-520d-5p	CLIP-seq
MIRT1416511	hsa-miR-524-5p	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416512	hsa-miR-548u	CLIP-seq
MIRT1416513	hsa-miR-557	CLIP-seq
MIRT1416514	hsa-miR-655	CLIP-seq
MIRT1416515	hsa-miR-155	CLIP-seq
MIRT1416516	hsa-miR-2053	CLIP-seq
MIRT1416517	hsa-miR-330-3p	CLIP-seq
MIRT1416518	hsa-miR-3609	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq
MIRT1416520	hsa-miR-4643	CLIP-seq
MIRT1416521	hsa-miR-466	CLIP-seq
MIRT1416522	hsa-miR-4781-5p	CLIP-seq
MIRT1416523	hsa-miR-4789-3p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416524	hsa-miR-494	CLIP-seq
MIRT1416525	hsa-miR-503	CLIP-seq
MIRT1416526	hsa-miR-548aa	CLIP-seq
MIRT1416527	hsa-miR-548ah	CLIP-seq
MIRT1416528	hsa-miR-548t	CLIP-seq
MIRT1416529	hsa-miR-569	CLIP-seq
MIRT1416530	hsa-miR-624	CLIP-seq
MIRT1416531	hsa-miR-656	CLIP-seq
MIRT2124906	hsa-miR-1258	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT2124907	hsa-miR-1910	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT2124908	hsa-miR-337-5p	CLIP-seq
MIRT2124909	hsa-miR-3658	CLIP-seq
MIRT2124910	hsa-miR-377	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT2124911	hsa-miR-4485	CLIP-seq
MIRT2124912	hsa-miR-455-3p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416480	hsa-miR-498	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416507	hsa-miR-505	CLIP-seq
MIRT1416485	hsa-miR-561	CLIP-seq
MIRT2124913	hsa-miR-602	CLIP-seq
MIRT2124914	hsa-miR-802	CLIP-seq
MIRT2124906	hsa-miR-1258	CLIP-seq
MIRT1416458	hsa-miR-1271	CLIP-seq
MIRT1416459	hsa-miR-1272	CLIP-seq
MIRT2347317	hsa-miR-181a	CLIP-seq
MIRT2347318	hsa-miR-181b	CLIP-seq
MIRT2347319	hsa-miR-181c	CLIP-seq
MIRT2347320	hsa-miR-181d	CLIP-seq
MIRT1416461	hsa-miR-182	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT2124907	hsa-miR-1910	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT2347321	hsa-miR-3156-3p	CLIP-seq
MIRT2347322	hsa-miR-3192	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT2347323	hsa-miR-3973	CLIP-seq
MIRT1416472	hsa-miR-4251	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq
MIRT2347324	hsa-miR-4262	CLIP-seq
MIRT2347325	hsa-miR-4301	CLIP-seq
MIRT1416473	hsa-miR-4420	CLIP-seq
MIRT2347326	hsa-miR-4426	CLIP-seq
MIRT2347327	hsa-miR-4436b-3p	CLIP-seq
MIRT2347328	hsa-miR-4447	CLIP-seq
MIRT2347329	hsa-miR-4472	CLIP-seq
MIRT2347330	hsa-miR-4477a	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT2347331	hsa-miR-4496	CLIP-seq
MIRT2124912	hsa-miR-455-3p	CLIP-seq
MIRT2347332	hsa-miR-4647	CLIP-seq
MIRT2347333	hsa-miR-4651	CLIP-seq
MIRT2347334	hsa-miR-4662b	CLIP-seq
MIRT2347335	hsa-miR-4717-3p	CLIP-seq
MIRT2347336	hsa-miR-4761-3p	CLIP-seq
MIRT2347337	hsa-miR-4761-5p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT1416524	hsa-miR-494	CLIP-seq
MIRT1416480	hsa-miR-498	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT2347338	hsa-miR-520g	CLIP-seq
MIRT2347339	hsa-miR-520h	CLIP-seq
MIRT2347340	hsa-miR-543	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT2347341	hsa-miR-548a-3p	CLIP-seq
MIRT2347342	hsa-miR-548e	CLIP-seq
MIRT2347343	hsa-miR-548f	CLIP-seq
MIRT2347344	hsa-miR-548l	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416485	hsa-miR-561	CLIP-seq
MIRT1416486	hsa-miR-564	CLIP-seq
MIRT1416487	hsa-miR-580	CLIP-seq
MIRT2124913	hsa-miR-602	CLIP-seq
MIRT2347345	hsa-miR-608	CLIP-seq
MIRT2124914	hsa-miR-802	CLIP-seq
MIRT1416489	hsa-miR-96	CLIP-seq
MIRT1416494	hsa-miR-183	CLIP-seq
MIRT2124907	hsa-miR-1910	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT2124912	hsa-miR-455-3p	CLIP-seq
MIRT2395593	hsa-miR-4686	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT2124913	hsa-miR-602	CLIP-seq
MIRT2640313	hsa-miR-1183	CLIP-seq
MIRT2124906	hsa-miR-1258	CLIP-seq
MIRT1416459	hsa-miR-1272	CLIP-seq
MIRT2640314	hsa-miR-135a	CLIP-seq
MIRT2640315	hsa-miR-135b	CLIP-seq
MIRT2347317	hsa-miR-181a	CLIP-seq
MIRT2347318	hsa-miR-181b	CLIP-seq
MIRT2347319	hsa-miR-181c	CLIP-seq
MIRT2347320	hsa-miR-181d	CLIP-seq
MIRT2640316	hsa-miR-191	CLIP-seq
MIRT1416463	hsa-miR-194	CLIP-seq
MIRT2640317	hsa-miR-2115	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT2640318	hsa-miR-3133	CLIP-seq
MIRT2640319	hsa-miR-3135	CLIP-seq
MIRT1416468	hsa-miR-3136-3p	CLIP-seq
MIRT2640320	hsa-miR-3591-3p	CLIP-seq
MIRT2640321	hsa-miR-3646	CLIP-seq
MIRT2640322	hsa-miR-3662	CLIP-seq
MIRT2640323	hsa-miR-3673	CLIP-seq
MIRT1416470	hsa-miR-380	CLIP-seq
MIRT2640324	hsa-miR-3913-3p	CLIP-seq
MIRT2347323	hsa-miR-3973	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq
MIRT2347324	hsa-miR-4262	CLIP-seq
MIRT1416499	hsa-miR-4310	CLIP-seq
MIRT2640325	hsa-miR-4419a	CLIP-seq
MIRT1416473	hsa-miR-4420	CLIP-seq
MIRT2640326	hsa-miR-4464	CLIP-seq
MIRT2347330	hsa-miR-4477a	CLIP-seq
MIRT1416476	hsa-miR-4495	CLIP-seq
MIRT2347331	hsa-miR-4496	CLIP-seq
MIRT1416500	hsa-miR-450b-5p	CLIP-seq
MIRT2640327	hsa-miR-4510	CLIP-seq
MIRT2640328	hsa-miR-4719	CLIP-seq
MIRT2640329	hsa-miR-4729	CLIP-seq
MIRT2640330	hsa-miR-4748	CLIP-seq
MIRT2640331	hsa-miR-4762-5p	CLIP-seq
MIRT1416506	hsa-miR-4789-5p	CLIP-seq
MIRT2640332	hsa-miR-489	CLIP-seq
MIRT1416524	hsa-miR-494	CLIP-seq
MIRT1416481	hsa-miR-499-3p	CLIP-seq
MIRT1416482	hsa-miR-499a-3p	CLIP-seq
MIRT1416508	hsa-miR-507	CLIP-seq
MIRT2640333	hsa-miR-513b	CLIP-seq
MIRT1416510	hsa-miR-520d-5p	CLIP-seq
MIRT2347338	hsa-miR-520g	CLIP-seq
MIRT2347339	hsa-miR-520h	CLIP-seq
MIRT1416511	hsa-miR-524-5p	CLIP-seq
MIRT2347340	hsa-miR-543	CLIP-seq
MIRT1416483	hsa-miR-545	CLIP-seq
MIRT2347341	hsa-miR-548a-3p	CLIP-seq
MIRT2640334	hsa-miR-548ad	CLIP-seq
MIRT2640335	hsa-miR-548c-3p	CLIP-seq
MIRT2347342	hsa-miR-548e	CLIP-seq
MIRT2347343	hsa-miR-548f	CLIP-seq
MIRT2347344	hsa-miR-548l	CLIP-seq
MIRT1416484	hsa-miR-548p	CLIP-seq
MIRT1416513	hsa-miR-557	CLIP-seq
MIRT2640336	hsa-miR-583	CLIP-seq
MIRT2640337	hsa-miR-595	CLIP-seq
MIRT2640338	hsa-miR-629	CLIP-seq
MIRT2640339	hsa-miR-664	CLIP-seq
MIRT2124914	hsa-miR-802	CLIP-seq
MIRT2640340	hsa-miR-890	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416467	hsa-miR-3120-3p	CLIP-seq
MIRT1416519	hsa-miR-4261	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Unknown	12799378
FOXA2	Unknown	22951069
GATA3	Unknown	22951069
HNF4A	Unknown	22951069
TP53	Repression	14990988

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12799378
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	19443654
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	20128911
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19443654
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	19443654
GO:0001222	Function	Transcription corepressor binding	IPI	19443654
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12799378
GO:0001568	Process	Blood vessel development	IMP	15578569
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9727977
GO:0005515	Function	Protein binding	IPI	11713475, 11713476, 16442529, 16569639, 16724116, 17283121, 17873903, 18193033, 18772112, 19202075, 19304756, 19816403, 20126258, 22014570, 22056988, 22304967, 24589551, 28829046, 30833792, 32296183
GO:0005634	Component	Nucleus	IDA	9065401, 16532032, 19304756, 19386626
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	19168596
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9727977
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008013	Function	Beta-catenin binding	EXP	11713476
GO:0008013	Function	Beta-catenin binding	IDA	9065401
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	11237626, 12408825, 19443654
GO:0009749	Process	Response to glucose	ISS	19168596
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	17072303
GO:0010909	Process	Positive regulation of heparan sulfate proteoglycan biosynthetic process	IMP	15853773
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016605	Component	PML body	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	12799378
GO:0019901	Function	Protein kinase binding	IPI	16714285
GO:0031016	Process	Pancreas development	TAS	18216022
GO:0032024	Process	Positive regulation of insulin secretion	IMP	19386626
GO:0032350	Process	Regulation of hormone metabolic process	IDA	15525634
GO:0032993	Component	Protein-DNA complex	IDA	14661054
GO:0042593	Process	Glucose homeostasis	IDA	15525634
GO:0043565	Function	Sequence-specific DNA binding	IDA	14661054
GO:0043565	Function	Sequence-specific DNA binding	IMP	16532032
GO:0043570	Process	Maintenance of DNA repeat elements	IMP	18755497
GO:0045295	Function	Gamma-catenin binding	IPI	14661054
GO:0045444	Process	Fat cell differentiation	IDA	10937998
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15525634
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16532032
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9065401, 19168596, 19443654
GO:0048625	Process	Myoblast fate commitment	IDA	10937998
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IMP	17122440
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	12408868
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19386626
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IC	9065401
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	12408825, 19443654
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17072303
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IDA	12799378
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16007074, 16434966, 17875931
GO:0070016	Function	Armadillo repeat domain binding	IPI	12408825
GO:0070369	Component	Beta-catenin-TCF7L2 complex	IDA	9065401, 9065402
GO:0071664	Component	Catenin-TCF7L2 complex	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	16532032
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	19386626
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990907	Component	Beta-catenin-TCF complex	IBA
GO:2000675	Process	Negative regulation of type B pancreatic cell apoptotic process	ISS
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	ISS

Other IDs

• MIM: 602228
• HGNC: 11641
• e!Ensembl: ENSG00000148737

Protein

• UniProt ID: Q9NQB0
• Protein name: Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4)
• Protein function: Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as a repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promote
• PDB: 1JDH, 1JPW, 2GL7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08347	CTNNB1_binding	1 → 259	N-terminal CTNNB1 binding	Family
  PF00505	HMG_box	350 → 418	HMG (high mobility group) box	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland an
• Sequence:

  MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
  DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
  LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
  AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
  PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
  HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
  MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
  DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPC
  RRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKP
  DPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSH
  SSLAGTQPQPLSLVTKSLE

• Sequence length: 619

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autism	Pathogenic	rs2137155220	RCV003223494	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental abnormality	Likely pathogenic	rs2137178800	RCV001754559	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Likely pathogenic	rs2136929776	RCV002274381	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL GLAUCOMA	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOPHYTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus type 2, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC POLYNEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPHTHALMOS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet, GenCC Disgenet, GenCC	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOMYELITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENILE CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TCF7L2-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TCF7L2-related Intellectual disability	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TCF7L2-relatedIntellectual disability	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACIC AORTIC ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 2 diabetes mellitus	Uncertain significance	ClinVar ClinVar, GWAS catalog ClinVar, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Accessory nipple	Accessory Nipple	HPO_DG			★☆☆☆☆ Found in Text Mining only
Accessory nipple	Accessory Nipple	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21390130, 30551418		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15667799, 23224985		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21892161		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	24836286, 26965516, 29471430, 30510241, 30529582		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23224985		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21892161		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21892161		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21892161		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18268006, 18478343, 19749792, 24846398		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18268006		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10021369, 10549354, 12086873, 12460462, 17920061, 18166348		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	23437103		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	23437103	Associate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30830316		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16306047, 38458367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	30805717		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30567484		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	20184619, 24058414, 24839169		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman syndrome	Pubtator	24058414	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	40303486	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27889647		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	34265237	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18268068, 18437354, 18650481, 18931037, 20142250, 20578204, 21423583		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12428226	Associate	★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12049819		★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	10813808		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18268068, 18437354, 18650481, 18931037, 20142250, 20578204, 21423583		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	18437354, 24371822	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	40303486	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	29322350	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24339136, 34003604	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	23453885		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASDB_DG	23453885		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28321286, 29228394, 31081034, 32971458, 36448207, 38287090	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23640545, 29228394, 31081034		★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	BEFREE	29933371		★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	20499253, 28289282		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	22521361, 29228394, 34003604, 35501322, 38287090	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	17436254, 38571311	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	17436254		★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic intellectual disability	Non-Syndromic Intellectual Disability	Orphanet			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29393352		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35654816	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36193501	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36193501	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10395212, 10712198, 10813808, 11526470, 23786914, 24322204, 26934194		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	10712198, 10813808, 11377748, 11526470, 23786914, 24322204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	23453885, 24322204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	28321286, 33116252, 34535768, 36193501	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29190896		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	32517078	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17295608	Associate	★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	17436254	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15547706		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	17109766, 19732438		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18289012, 18347142, 20603605, 21301999, 22318732, 22805760, 23085767, 23306204, 23951231, 24266846, 24338422, 24752740, 25499975, 25867435, 27053251, 27738320, 29307786, 29666142, 31049030, 31300015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 23544013, 25751625, 27117709, 29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASDB_DG	23544013		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	16003740, 17109766, 18302196, 19732438, 21772333, 22318732, 22805760, 23085767, 23516639, 23721519, 23914993, 24325915, 27053251, 27738320, 28351929, 28791367, 31311202, 34340678, 35996498	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24338422	Inhibit	★☆☆☆☆ Found in Text Mining only
Bruxism	Bruxism	Pubtator	29322350	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	28320060		★☆☆☆☆ Found in Text Mining only
Carbohydrate Metabolism Inborn Errors	Carbohydrate metabolism disease	Pubtator	35292917	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15802015, 21892161, 23029137, 23651211, 24528029, 28117551, 32203164, 36609428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	33398982	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12939742, 18755497, 24846398		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29060924	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12378619, 19089909, 21256126, 23437103, 23562475, 23651211, 25311538, 28300839, 29620186, 30249289, 31698564, 32521895	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29190896		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31436384		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15667799, 17768662, 18268068, 26535715, 27046058, 28949031, 30527807, 31632059		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30614797	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34598322, 39366533	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15806138, 28099906	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31300015		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21892161		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21892161		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19732438, 30614797		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	27301468		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	18239663	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	29394407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28216152		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	29394407		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18437354, 19141698, 19924244, 22712642, 23942586, 24574000, 25353718, 28299838		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19141698, 22712642, 23942586, 24574000, 25353718	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	23603903	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21921652, 23942586, 24529562		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27181358, 28165569, 31298314, 31571923		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27181358, 28165569, 31298314, 31571923		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	23453885, 28540026		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30830316		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASDB_DG	22821403		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	22821403		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	24574000		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18650481, 24864085		★☆☆☆☆ Found in Text Mining only
Chronic Liver Failure	Liver failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24592811		★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	26343600		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29604340		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26343600, 27689884, 28951451		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27689884, 29105523	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	17661009, 38065904	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24118792	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11997022, 15667799, 15905022, 17909039, 18268068, 18398040, 19190323, 22961697, 23951231, 24869759, 29455637, 29805612, 29975781, 31392276, 31608135		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11470825, 21625458, 21892161, 22402060	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15905022, 18268068, 18398040		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21383188, 27433921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	21383188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10485457, 11528255, 11751382, 11980438, 12036905, 12185585, 12633551, 15141037, 15928669, 16547505, 17906625, 18177486, 18268006, 18478343, 18519685, 18621708, 18951899, 19059704, 19124064, 19394332, 19561604, 19787250, 20027603, 20530691, 20823162, 21892161, 21983179, 22080605, 22419714, 22429595, 23029137, 23951231, 24317174, 24398765, 24608966, 24846398, 24952462, 25131200, 25348333, 25961950, 26240283, 26619963, 26884349, 27310872, 27755946, 27792933, 28051067, 28060743, 28356933, 28472810, 28921929, 29245969, 30026326, 30253791, 30365932, 30693973, 30970512, 31292489, 31485167, 31540772		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	21892161, 24836286		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	24836286		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	24836286, 26965516, 29471430, 30510241, 30529582		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11980438, 12036905, 17920061, 18992165, 25131200, 26619963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11980438, 16547505, 17143297, 17983804, 18478343, 18621708		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12408868, 15141037, 15928669, 16569639, 17167838, 17360646, 18268006, 18268068, 18398040, 18478343, 18621708, 18992165, 19190323, 20065031, 20460455, 21057000, 21092222, 21668942, 21892161, 21983179, 22108803, 23029137, 23629434, 23844215, 24151146, 24317174, 24338422, 24608966, 25034524, 25483087, 25617745, 25659031, 25961950, 26474385, 26884349, 27221540, 27292638, 27398792, 27769063, 28574827, 29118424, 29135090, 29301589, 29975781, 30072583, 30097457, 30970512, 31127692, 31392276, 32170005, 32203164, 32265994, 32552466, 33422939, 33787608, 34957998, 35279145, 35893034, 36609428, 36800588, 37191369, 38492821, 39587554	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	21892161, 24836286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	24836286, 26965516, 29471430, 30510241, 30529582		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complex partial seizures	Seizure	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	28807867		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	22071887		★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27301468		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12796377, 20095040, 27572476, 31729097		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	22998502		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	23758498, 28284480, 29526280		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Fuchs' endothelial 1	Corneal dystrophy	Pubtator	36883248	Associate	★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 3	Corneal Endothelial Dystrophy	BEFREE	21245398		★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 3	Corneal Endothelial Dystrophy	GENOMICS_ENGLAND_DG	26401622		★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 3	Corneal Endothelial Dystrophy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 3	Corneal Endothelial Dystrophy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19055834, 19924244, 21423583, 22843023, 26489464, 30567484		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19055834, 19924244, 21423583, 22843023, 26489464, 28595632, 30567484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	19924244, 21423583, 24098343, 28595632, 33752320, 39600283, 40303486, 40485517	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	19055834, 33122478	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	19055834, 19924244, 22843023, 26489464, 30567484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	19055834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	CTD_human_DG	28869590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	17709525, 19221600, 19904243		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17709525		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19221600, 22393312	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CLINVAR_DG	21671391, 24077912		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	19585101, 30639531, 31697830		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19585101, 23050589, 31697830	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23603903, 27018594, 30930294, 31678554		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	17181866	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28341444, 28949784, 30626913		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	36734726	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36734726	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	22460224		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	25307298, 26993267, 27689884, 29228394, 29695756, 34003604, 35908153	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16855264, 16936215, 17181866, 17311858, 17429603, 17476472, 17601994, 17671643, 17903298, 17977958, 18268068, 18291022, 18302196, 18310307, 18398040, 18650481, 18702948, 18706099, 18806947, 18931037, 18972257, 19050058, 19055834, 19105201, 19141698, 19149908, 19169495, 19183934, 19585101, 19806338, 20028944, 20217507, 20578204, 20616309, 20640398, 20682688, 20849430, 20980453, 21159844, 21349175, 21423583, 21441683, 21672010, 21673050, 21814547, 22441719, 22461567, 22712642, 22872755, 23085767, 23942764, 24128935, 24468095, 24529562, 24906949, 25058603, 25185853, 26525881, 26555947, 26914832, 26934194, 27465520, 27623947, 27792933, 27998387, 28101933, 28102847, 28219675, 28299838, 29246974, 29993315, 30290587, 30419301, 30467975, 31049566, 31312258, 31619789, 31691451		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	33752320	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	17317761, 17342473, 20540670, 20682688, 21672010, 22480428, 25973943, 27173344, 27465520, 28072873, 28133617, 28699988, 29947923, 30614312, 33352264, 33953693, 35966063, 37107681, 37779084	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16855264, 16936215, 17181866, 17311858, 17429603, 17476472, 17601994, 17671643, 17903298, 17934151, 17977958, 18268068, 18282631, 18291022, 18302196, 18310307, 18398040, 18650481, 18702948, 18706099, 18806947, 18931037, 18972257, 19050058, 19055834, 19105201, 19141698, 19149908, 19169495, 19183934, 19585101, 19806338, 20028944, 20217507, 20578204, 20616309, 20640398, 20682688, 20800300, 20849430, 20980453, 21159844, 21349175, 21423583, 21441683, 21672010, 21673050, 21814547, 21857094, 22441719, 22461567, 22712642, 22872755, 23041303, 23085767, 23942764, 24128935, 24468095, 24529562, 24906949, 25058603, 25185853, 26525881, 26555947, 26914832, 26934194, 27465520, 27623947, 27792933, 27998387, 28101933, 28102847, 28219675, 28299838, 29246974, 29993315, 30290587, 30419301, 30467975, 31049566, 31312258, 31619789, 31691451		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	16855264, 17181866, 17317761, 17671643, 17697858, 17903298, 18268068, 18302196, 18398040, 18437354, 18650481, 18719881, 18931037, 19050058, 19055834, 19141698, 19585101, 19864407, 19924244, 20028944, 20299486, 20578204, 20682688, 20929593, 20980453, 21349175, 21423583, 21814547, 21857094, 22461567, 23085767, 23577093, 23804578, 23942764, 24128935, 24205231, 25058603, 26525881, 26608632, 26822092, 26958016, 27173344, 27465520, 27623947, 27998387, 29025879, 29396371, 31049566, 31070566, 31691451, 31972003, 32182220, 32366963, 32651957, 32814780, 33122478, 33257854, 33352264, 33479058, 34535768, 35436882, 35442800, 35822422, 36263318, 36282337, 36360783, 36837510, 38189041, 39874951	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18282631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	29135090	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29025879, 30275285, 30467975, 31167894, 33352264, 34326068, 36282337, 36300877	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16855264, 17020404, 17109766, 17181866, 17245589, 17317761, 17416797, 17463248, 17503332, 17593304, 17653210, 17661009, 17668382, 17671643, 17671651, 17683561, 17697858, 17971425, 18059616, 18239663, 18291022, 18310307, 18443202, 18461161, 18469204, 18478343, 18498634, 18598350, 18655717, 18694974, 18706099, 18719881, 18931037, 19020324, 19033397, 19050058, 19055834, 19056611, 19183934, 19211816, 19247628, 19258437, 19288077, 19351735, 19368707, 19401414, 19526209, 19573884, 19585101, 19602480, 19615048, 19636253, 19643578, 19713311, 19718565, 19732438, 19789636, 19864407, 19924244, 19934000, 20028944, 20032493, 20033802, 20097709, 20107109, 20118932, 20142250, 20161779, 20361036, 20424228, 20540670, 20548773, 20682688, 20967696, 20980453, 21103350, 21109996, 21133856, 21150882, 21349175, 21399856, 21441683, 21672010, 21707949, 21814547, 21911746, 21913056, 21921652, 21949744, 22052079, 22101970, 22247771, 22275441, 22296403, 22301903, 22402060, 22480428, 22529894, 22558147, 22583123, 22782288, 22865700, 22916254, 22923468, 22951069, 23034957, 23085767, 23104008, 23144361, 23193118, 23462794, 23617586, 23626757, 23629434, 23825961, 23942586, 24059590, 24062323, 24205231, 24574000, 24603685, 24637646, 24667787, 24906949, 24914535, 24925104, 25058603, 25185411, 25273842, 25274455, 25299103, 25483131, 25491720, 25498973, 25973943, 26083111, 26201011, 26273662, 26345943, 26367734, 26393635, 26599349, 26604685, 26822092, 26914832, 26958016, 27053251, 27207554, 27230431, 27281091, 27310578, 27323175, 27383215, 27623947, 27929407, 27958632, 27983772, 27998387, 28040731, 28183453, 28220878, 28253288, 28254843, 28263491, 28438156, 28587604, 28595632, 28611053, 28699988, 29025879, 29182660, 29326107, 29631902, 29675560, 29871606, 30212457, 30275285, 30467975, 30600310, 30614312, 30656477, 30702596, 30814579, 31049566, 31049640, 31070566, 31083695, 31123324, 31125083, 31167894, 31492908, 31504696, 31676834, 31691451, 31697830, 31775533, 32127821, 32578971, 32814780, 32948839, 33122478, 33352264, 33479058, 33752320, 33761736, 33784687, 33972266, 34200102, 34265237, 34326068, 34394276, 34515148, 34669858, 35096319, 35292917, 35334875, 35436882, 35442800, 35697299, 35893034, 35966063, 36182916, 36282337, 36300877, 36674502, 36734726, 36834424, 36966366, 37234928, 37234929, 37606143, 38096208, 38353623, 38367620, 39874951, 40225014, 40303486, 40485517	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19033397, 19368707, 21873549, 23527042, 24376643, 24953961, 33752320	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17683561, 18310307, 19533015, 20546291, 22558147, 25189437, 27027642, 28438156, 29025879, 30275285, 30456822, 31167894		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16415884, 16855264, 16936215, 16936216, 16936217, 16936218, 17003358, 17003360, 17020404, 17031610, 17065361, 17093941, 17109766, 17130514, 17181866, 17206141, 17226113, 17245407, 17245589, 17259383, 17293876, 17311858, 17317761, 17331067, 17340123, 17416797, 17429603, 17437080, 17460697, 17463248, 17466512, 17470138, 17476472, 17503332, 17519421, 17563454, 17579206, 17579832, 17593304, 17601994, 17609304, 17618413, 17653210, 17661009, 17665514, 17668382, 17671643, 17671651, 17683561, 17697858, 17725629, 17805508, 17888129, 17909099, 17934151, 17971425, 17972059, 18072015, 18097733, 18210030, 18239663, 18282631, 18291022, 18310307, 18342627, 18397358, 18443202, 18445358, 18461161, 18469204, 18478343, 18493736, 18498634, 18541996, 18546086, 18555673, 18597214, 18598350, 18599616, 18655717, 18694974, 18702948, 18706099, 18712344, 18762805, 18806947, 18839133, 18853134, 18931037, 18972257, 18984664, 19012045, 19033397, 19050058, 19053027, 19055834, 19056611, 19082521, 19149908, 19168596, 19183934, 19184112, 19211816, 19214925, 19225753, 19228405, 19247628, 19251050, 19258437, 19286335, 19288077, 19351735, 19368707, 19473183, 19482368, 19506043, 19509102, 19526209, 19533015, 19573884, 19585101, 19592620, 19602480, 19643578, 19713311, 19718565, 19732438, 19789636, 19806338, 19864407, 19885641, 19915463, 19924244, 19934000, 20028944, 20032493, 20033802, 20043853, 20054294, 20097709, 20107109, 20118932, 20142250, 20161779, 20217507, 20361036, 20503258, 20540670, 20546291, 20550665, 20597906, 20640398, 20675304, 20682688, 20739883, 20878272, 20878273, 20957343, 20980453, 21109996, 21114608, 21115178, 21150882, 21159844, 21169132, 21349175, 21357677, 21384500, 21399856, 21414605, 21423583, 21437630, 21441683, 21510814, 21543200, 21641671, 21673050, 21678030, 21814547, 21834909, 21898192, 21911746, 21913056, 21921652, 21949744, 21965303, 22101970, 22109281, 22136959, 22245614, 22247771, 22275441, 22296403, 22301903, 22377712, 22402060, 22406741, 22441719, 22529894, 22552033, 22558147, 22584884, 22749234, 22782288, 22843023, 22865700, 22872755, 22885420, 22923468, 22936689, 23010200, 23011354, 23018631, 23028378, 23034957, 23041303, 23085767, 23107111, 23142382, 23144361, 23188737, 23235198, 23249316, 23295285, 23311683, 23434931, 23456907, 23492873, 23527042, 23527206, 23536853, 23558246, 23579632, 23617586, 23626757, 23670970, 23825961, 23942586, 24002895, 24059590, 24145053, 24157263, 24205231, 24214952, 24322204, 24376643, 24468095, 24485399, 24529562, 24574000, 24639413, 24667787, 24906949, 24914535, 24925104, 24961829, 25015099, 25058603, 25117344, 25185853, 25189437, 25274455, 25299103, 25393876, 25398947, 25483131, 25491720, 25498973, 25627047, 25839936, 25973943, 26046964, 26058934, 26083111, 26109524, 26247673, 26273662, 26316572, 26345943, 26367734, 26393635, 26499758, 26536002, 26576435, 26599349, 26604685, 26681031, 26822092, 26914832, 26919830, 27053251, 27121852, 27230431, 27310578, 27323175, 27480250, 27488727, 27539148, 27623947, 27639123, 27706609, 27929407, 27983772, 27998387, 28040731, 28067832, 28101933, 28183453, 28220878, 28253288, 28343277, 28438156, 28465699, 28587604, 28595632, 28851992, 29025879, 29100364, 29314572, 29317436, 29326107, 29331016, 29458357, 29514658, 29631902, 29675560, 29717269, 29802808, 29871606, 29967064, 29971604, 29993315, 30172742, 30212457, 30419301, 30467975, 30614312, 30656477, 30700996, 30702596, 30708140, 30718095, 30729689, 30776466, 30814579, 30899283, 30948248, 31049566, 31049640, 31070566, 31083695, 31121319, 31123324, 31125083, 31167894, 31288068, 31312259, 31478326, 31492908, 31495395, 31504696, 31546272, 31676834, 31691451, 31697830, 31759989, 31775533, 31829936		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	16415884, 17093941, 17470138, 17697858, 17971425, 18702948, 19228405		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17293876, 17460697, 17463246, 17463248, 17463249, 17554300, 17668382, 18372903, 19056611, 19401414, 19734900, 20581827, 20694148, 21347282, 22101970, 22693455, 22885922, 23209189, 23300278, 23945395, 24390345, 24509480, 25102180, 25483131, 26818947, 26961502, 27189021, 28254843, 28869590, 29358691, 30054458, 30470734, 30595370, 30718926, 31049640, 31118516, 31324766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17293876, 17460697, 17463246, 17463248, 17463249, 17554300, 17668382, 18372903, 19056611, 19184112, 19401414, 20581827, 20818381, 21647700, 21874001, 22101970, 22325160, 22693455, 22885922, 23209189, 23300278, 23670970, 23945395, 24390345, 24509480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	17460697, 23104008, 28869590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	22109281		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	18437354		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17653210, 24574000, 24864085, 30290587, 38189041	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17653210, 19506043, 20803090, 24574000, 25185853, 26986145, 30290587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	27253191	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22843023, 25117344, 25274455, 26316572		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25274455, 35677638	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31217338		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	35677638	Associate	★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	17436254		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	22781169		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17972059, 19105201, 26576435, 28465699		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	19141698		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	19141698, 35341056, 40225014	Associate	★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	17436254, 17436255, 17478476, 18081026, 18627065, 18728071, 19235238, 19938247, 20825314, 21245398, 21533127, 21671391, 22045651, 22335494, 22460224, 22581936, 22678594, 22712893, 23185296, 26087656, 27072915, 28807867		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	23248353, 27179618		★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10597289, 15806138, 17607667, 18798221, 19787250, 31815037		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15806138		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15806138	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27055116	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23528641, 29604340		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30614797		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28536608		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28536608		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28536608, 32035486, 35484214	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28536608	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31155838		★☆☆☆☆ Found in Text Mining only
Exostoses Multiple Hereditary	Exostoses	Pubtator	25498973	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	36135330	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	19105201		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	19105201		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fish-Eye Disease	Fish-Eye Disease	BEFREE	22146553, 22234156, 26087656		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	20825314, 21245398, 21659310, 24094747, 25299301		★☆☆☆☆ Found in Text Mining only
Fuchs endothelial corneal dystrophy	Fuchs Endothelial Dystrophy	Orphanet			★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	20825314, 21245398, 21533127, 21659310, 22146553, 22234156, 22998502, 23110055, 23185296, 24094747, 24255041, 24917144, 25168903, 25298419, 25299301, 25342617, 25593321, 25722209, 26087656, 26200491, 26218914, 26401622, 26451375, 26622166, 27121161, 27755191, 28118661, 28608272, 28832669, 28886202, 29196769, 29325021, 29526280, 29677003, 29677349, 29799290, 29966009, 30025114, 30098193, 30267097, 30676271, 30733599, 30811544, 30973406, 31028223, 31276570, 31469403, 31554942, 31560764		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	GWASCAT_DG	20825314		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	ORPHANET_DG	23185296		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	20825314, 21245398, 21533127, 22146553, 22234156, 22321803, 23110055, 23185296, 24094747, 24255041, 24917144, 25168903, 25298419, 25593321, 25722209, 26200491, 26451375, 26622166, 27121161, 27755191, 28118661, 28358029, 28832669, 28886202, 29044056, 29196769, 29325021, 29677003, 29677349, 29966009, 30025114, 30098193, 30676271, 30733599, 30811544, 30973406, 31028223, 31276570, 31469403, 31554942, 31560764, 32463444, 32934897, 33116252, 34644448, 34855896, 34946867, 34946954, 35676652, 36773096, 37204786, 38206443, 39278108, 39332053	Associate	★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	35900539	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	11528255		★☆☆☆☆ Found in Text Mining only
Generalized amyotrophy	Amyotrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23295773		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23295773, 31410187, 9668116	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23295773		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21636708, 21720709, 25301232, 26708597, 27736002, 28949031, 29436621, 30503496		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26708597, 27736002	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	21544580, 23640545		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG	21671391, 24077912		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	23705960	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	16844662		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27301468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	10800967	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	14770182		★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	25498973		★☆☆☆☆ Found in Text Mining only
Hiatal Hernia	Hiatal Hernia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	17436255		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17065361, 18853134, 20299486, 20682688, 22461567, 23028378, 23086040, 24906949, 26367734, 30063936		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	17065361		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19864407, 20185807, 20299486, 20682688, 26367734, 32182220	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	19211816		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	20185807	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	17972059, 20739883		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	19141698, 22916254	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24913829	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Immediate	Hypersensitivity	Pubtator	17206141	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23942764, 32013702, 33752320, 34001234, 37816730	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23942764		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	17181866, 19864407, 20299486, 20578204, 33352264	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28343277		★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35484214	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18478089	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26343600, 27689884, 29105523		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17709525, 19904243, 19998456, 30410494		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17317761, 17671651, 19351735, 20032493, 20107109, 22301903, 25274455, 26087292, 26634513, 27998387, 28183453, 31070566, 32651957, 39600283	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17436255, 18627065, 21932083, 22460224, 23640545, 24058414, 24906019, 27132474, 27179618, 29228394, 29695756, 29933371, 31081034		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Intellectual developmental disorder	Pubtator	17436255, 24058414, 27179618, 27689884, 29228394, 29695756, 31081034, 32481733, 34003604, 38571311	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Mental retardation	LHGDN	18627065		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30245464		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	16007074, 25131200		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	17920061, 21383188		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	21921652	Associate	★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36883248	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	29959006		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17601994, 25185853		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18650481, 33752320	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24574000	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29733821, 31216555		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	24574000		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	35908153	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31436384	Associate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	19533015, 22109281, 30456822, 31125083		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	30656477, 31125083	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	24534281	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15905022, 28251886, 30740945		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15905022		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19131553, 30593567	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30315825, 30593567, 32068780	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32517078	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29950146, 30315825		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31452252		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12378619, 12603528, 14687479, 15040893, 18429952, 21256126, 23030478, 23437103, 23558246, 23562475, 23648141, 23651211, 24190507, 28300839, 29620186, 30914432, 31340839, 31352197, 31666105		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35338348	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17768662, 18048388		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18268068, 26535715, 26823848, 27014877, 35897813	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30614797	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31211453	Associate	★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	10395212, 10712198, 11526470		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10395212, 10712198, 11526470		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	10395212, 10712198, 11526470		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	10395212, 10712198, 11526470		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	10395212		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	10395212		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	10395212		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	23453885, 29662059, 29700475, 29942085, 30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	28989100, 30729689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	21720709		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18289012, 18347142, 20603605, 21301999, 22318732, 22805760, 23085767, 23306204, 23516639, 23951231, 24266846, 24338422, 24752740, 25499975, 25867435, 27053251, 27738320, 29307786, 29666142, 31049030, 31300015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19787250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28536608		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	11528255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19562778		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	24836286, 26965516, 29471430, 30510241, 30529582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15040893, 22768190		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15667799, 17768662, 18268068, 26535715, 27046058, 28949031, 30527807, 31632059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31452252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19732438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25516658, 29476053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16428447, 17523142, 18302196, 20142250, 23951231, 24961829, 25678841, 31536510		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16311123, 18635522, 18755497, 27605886, 30127921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29190896		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17109766, 18268068, 18289012, 18302196, 18621708, 19749792, 20027603, 20065031, 20473943, 20640398, 21956205, 21963845, 22885420, 23558246, 23951231, 24468095, 24608966, 25744721, 26240283, 26645562, 26708597, 27738320, 27846392, 28470180, 28949031, 29455637, 30548288, 30867651, 30979828, 31419437, 31829936		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27181358, 28165569, 31298314, 31571923		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11997022, 15667799, 15905022, 17909039, 18268068, 18398040, 19190323, 22961697, 23951231, 24869759, 28574827, 29455637, 29805612, 29975781, 31392276, 31608135		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	21383188		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	24836286, 26965516, 29471430, 30510241, 30529582		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17109766		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20603605		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30830316		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10549354, 21599871		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16645588, 19269971, 26968260, 38181739	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28949784, 30626913		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22521361, 27305091, 28289282, 29105523		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17436255, 18627065, 21932083, 22460224, 24058414		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22904171, 24205231	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	17181866, 19141698, 25353718, 33352264, 36263318, 37816730	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17226113, 18853134, 19141698, 20503258, 21115178, 21543200, 28465699, 29971604		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	20694148		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	20694148		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microlissencephaly	Microlissencephaly	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	BEFREE	27179618		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	30315825		★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	27440233	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CLINVAR_DG	17436254, 17436255, 17478476, 18081026, 18627065, 18728071, 19235238, 19938247, 20825314, 21245398, 21533127, 21671391, 22045651, 22335494, 22460224, 22581936, 22678594, 22712893, 23185296, 26087656, 27072915, 28807867		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31484947, 36250467	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	17295608, 30172742	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30315825		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30315825	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28901467		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17181866	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28299838, 31419437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	29394407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	GWASCAT_DG	27182965		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	34003604	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	30025114		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	30025114	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27891591, 30867651		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10489374, 10597289, 10918391, 11396184, 11876551, 11980438, 12378619, 15667799, 16311123, 17768662, 18621708, 18635522, 18755497, 18951899, 18992263, 19635457, 20027603, 20095040, 20585880, 20603605, 21383188, 21636708, 21668942, 22080605, 22529186, 23030478, 23124040, 24846398, 24943349, 25519018, 26884349, 27046058, 27129219, 27542264, 27891591, 28467300, 29666142, 30830316, 31166600, 31341493, 31571923, 31805518		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	24864085		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	24864085		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	29959006		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	40149012	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23132673		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	23132673	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24058414		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31535015, 33000697	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	21228604, 22521361, 26194112, 29228394, 29933371, 30830316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	19105201		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15667799, 30536319, 31805518		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	19105201		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	22832956, 24275585		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	24275585		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17311858, 18239663, 18342627, 18469204, 18702948, 18853134, 19056611, 19183934, 19286335, 19760027, 21921652, 22109281, 22136959, 23086040, 23825961, 27650258, 27792933, 27929407, 27998387, 28420445, 30006590, 30027476, 30899283, 30948248, 31167894		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18059616, 18239663, 18469204, 18931037, 19056611, 19183934, 19526209, 20032493, 20097709, 20578204, 21707949, 21921652, 23132673, 23626757, 23825961, 24062323, 25224558, 26273662, 26608632, 27377425, 27929407, 27998387, 28611053, 28699988, 29220676, 30275285, 31972003, 32788279, 32835373, 32948839, 33122478, 34200102, 34578944, 35401881, 35894080, 36837510, 37816730, 38065904, 39600283, 39874951, 40225014	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	35697299	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	27998387, 34340678, 40225014	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22016394		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22513174, 32819387, 33675175, 35322736	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	23603903	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30172742		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30172742, 35373860	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29901121		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38254188	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19732438		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11943708, 36721777	Associate	★☆☆☆☆ Found in Text Mining only
Pallister-Hall syndrome	Pallister-Hall Syndrome	BEFREE	17436254, 17478476, 18222743, 18627065, 18781613		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25516658, 29476053		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25910082, 28099906, 29476053, 30548288	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	18706099	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21814573		★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	PSYGENET_DG	24718684		★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	24718684	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36869069	Associate	★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31037731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	31775533	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	18437354, 31775533		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	31285632		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21228734		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	21228734		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	21228734		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	31775533		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	23640545, 31081034		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	23434931		★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	BEFREE	17436254, 17436255, 17478476, 18222743, 18627065, 18635522, 18728071, 18781613, 19235238, 19813260, 19938247, 20184619, 20421335, 21544580, 21671391, 22045651, 22335494, 22383159, 22460224, 22678594, 22777675, 23248353, 23528641, 23640545, 24058414, 24413739, 24839169, 27132474, 27179618, 27270050, 27689884, 28807867, 28951451, 29318938, 29588831, 29604340, 29695756, 29933371, 30375316, 30830316, 31081034, 31845732		★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	CLINGEN_DG	17436254, 17436255, 17478476, 17878293, 18728071, 19235238, 25356899, 27568567, 29222403		★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	UNIPROT_DG	17436254, 17436255, 18728071, 19235238, 20184619, 22045651, 22777675, 25356899		★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	CTD_human_DG	17436254, 18728071		★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	GENOMICS_ENGLAND_DG	17436255, 18728071, 24896178		★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	CLINVAR_DG	18728071, 19235238, 21671391, 22045651, 22460224, 22777675, 24077912, 26633545, 26993267, 28631899, 28807867		★☆☆☆☆ Found in Text Mining only
Pitt-Hopkins syndrome	Pitt-Hopkins Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
PITT-HOPKINS SYNDROME	Pitt-Hopkins Syndrome	ORPHANET_DG	30450687		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17805508, 18958766, 19351735, 19718565, 20041287, 20092643, 22296403, 22301903, 22443257, 22480428, 23935130, 24157263, 24611738, 24815492, 25678248, 26536002, 26563606, 28139539, 31470081		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	17805508		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	18958766, 19351735, 22296403, 22301903, 22904171, 37606143	Associate	★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30551418		★☆☆☆☆ Found in Text Mining only
Premature adrenarche	Premature adrenarche	BEFREE	19497595		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	29447237		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	22821403, 24594265		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	ORPHANET_DG	22821403		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	Orphanet			★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	23434931		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16428447, 17523142, 18302196, 20142250, 23951231, 24961829, 25678841, 31536510		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16291872, 18302196		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18302196, 20142250, 23193118, 25678841	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31089877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	31089877	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychomotor Disorders	Psychiatric disorders	Pubtator	19938247	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	19643578, 24339136	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	22832956, 24275585, 24339136		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	24275585		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30225220		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	17659738, 21983179, 28811361		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	17659738		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	28341444		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19562778		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12796377, 31729097		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	24864085		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	37761846	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	22843023, 23434931		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	22383159		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	26740508, 29322350	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22885420		★☆☆☆☆ Found in Text Mining only
Sacral defect and anterior sacral meningocele	Sacral defect	Pubtator	21671075	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	19643578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	19643578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	10395212, 10813808, 19571808, 19643578, 20421335, 20434134, 20673877, 20934321, 21228604, 21414605, 21543597, 21791550, 21812098, 21932083, 21946175, 22247771, 22451930, 22781169, 22832956, 23129290, 23249814, 23640545, 23786914, 23894747, 24058414, 24275585, 24339136, 24413739, 24594265, 24686180, 24718684, 25217366, 25658856, 25858580, 26010163, 26343600, 27103199, 27270050, 27305091, 27689884, 27837920, 28404897, 28951451, 29105523, 29228394, 29287625, 29588831, 29599094, 29713286, 29905862, 30288643, 30626913, 30729689, 30771755, 31081034, 31142819, 31191620, 31535015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	19571808, 19571811, 21926974, 22688191, 23453885, 23894747, 25056061, 26198764, 28540026, 30285260, 30470734, 31268507, 31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	19571808, 19571811, 21791550, 21926974, 23894747		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19571808, 22247771, 22781169, 22883350, 24058414, 24339136, 24718684, 25658856, 27689884, 28321286, 29105523, 29228394, 30626913, 31081034, 31535015, 35501322, 40149012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19643578, 21414605, 22046400, 22247771, 24058414, 24275585, 24718684, 25217366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	37587067	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	19938247	Associate	★☆☆☆☆ Found in Text Mining only
Severe Congenital Microcephaly	Congenital Microcephaly	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	17436255, 17478476, 18728071, 20421335, 20434134, 23640545, 24413739, 27179618		★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	35154161	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28921696		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30600310	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spider hemangioma	Spider hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15667799, 29312594		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28536608, 30557604		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26356417, 33315534, 33723940	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28467300		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18635522, 20585880, 27605886, 30127921		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	24528029	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16311123		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18635522, 21042278, 24528029, 25400723, 27605886, 28076475, 31599413, 33458917, 34686186, 35864968, 35874675	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21921652, 23942586	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	31419437		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21814573, 33371788	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	21921652		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	21921652		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24325915, 37306188	Associate	★☆☆☆☆ Found in Text Mining only
TROPICAL CALCIFIC PANCREATITIS	TROPICAL CALCIFIC PANCREATITIS	BEFREE	18706099		★☆☆☆☆ Found in Text Mining only
Tropical Calcific Pancreatitis	Tropical calcific pancreatitis	Pubtator	18706099	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17709525, 20027603, 22821403		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28989100		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	29608334		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28165569, 30678687, 31298314, 32572909	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	18728071		★☆☆☆☆ Found in Text Mining only