TCEAL9 (transcription elongation factor A like 9)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51186
Gene name Transcription elongation factor A like 9
Gene symbol TCEAL9
Synonyms (NCBI Gene)
WBP5WEX6
Chromosome X
Chromosome location Xq22.2
Summary The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301158 30084 ENSG00000185222
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UHQ7
Protein name Transcription elongation factor A protein-like 9 (TCEA-like protein 9) (Transcription elongation factor S-II protein-like 9) (WW domain-binding protein 5) (WBP-5)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04538 BEX 1 → 102 Brain expressed X-linked like family Family
Sequence 
MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDI
HNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM
Sequence length 104
Interactions View interactions

No strongly related genes found yet for TCEAL9.

No additional diseases found yet through genes similar to TCEAL9.