TCEAL5 (transcription elongation factor A like 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340543
Gene name Transcription elongation factor A like 5
Gene symbol TCEAL5
Synonyms (NCBI Gene)
WEX4
Chromosome X
Chromosome location Xq22.1
Summary This gene, which is located on the X chromosome, encodes a protein which contains a BEX (brain expressed X-liked like family) domain. This domain is found in proteins encoded by the TCEAL elongation factor (transcription elongation factor A (SII)-like) ge
miRNA miRNA information provided by mirtarbase database.
17 Show/Hide all (17)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT441794 hsa-miR-2115-3p PAR-CLIP 22100165
MIRT441794 hsa-miR-2115-3p PAR-CLIP 22100165
MIRT441794 hsa-miR-2115-3p PAR-CLIP 22100165
MIRT441794 hsa-miR-2115-3p PAR-CLIP 22100165
MIRT1415661 hsa-miR-4422 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20195357
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301155 22282 ENSG00000204065
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5H9L2
Protein name Transcription elongation factor A protein-like 5 (TCEA-like protein 5) (Transcription elongation factor S-II protein-like 5)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04538 BEX 1 → 182 Brain expressed X-linked like family Family
Sequence 
MEKLYKENEGKPENERNLESEGKPEDEGSTEDEGKSDEEEKPDMEGKTECEGKREDEGEP
GDEGQLEDEGNQEKQGKSEGEDKPQSEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKT
DRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFA
PRGQRGVRGVRGGGRGQKDLEDVPYV
Sequence length 206
Interactions View interactions

No strongly related genes found yet for TCEAL5.

No additional diseases found yet through genes similar to TCEAL5.