TCEAL2 (transcription elongation factor A like 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 140597
Gene name Transcription elongation factor A like 2
Gene symbol TCEAL2
Synonyms (NCBI Gene)
MY0876G05WEX1my048
Chromosome X
Chromosome location Xq22.1
Summary This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.
miRNA miRNA information provided by mirtarbase database.
16 Show/Hide all (16)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1415581 hsa-miR-2278 CLIP-seq
MIRT1415582 hsa-miR-376c CLIP-seq
MIRT1415583 hsa-miR-3973 CLIP-seq
MIRT1415584 hsa-miR-4422 CLIP-seq
MIRT1415585 hsa-miR-4724-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301152 29818 ENSG00000184905
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H3H9
Protein name Transcription elongation factor A protein-like 2 (TCEA-like protein 2) (Transcription elongation factor S-II protein-like 2)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04538 BEX 84 → 205 Brain expressed X-linked like family Family
Sequence 
MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKD
KEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPES
ETRAAGKRPAEDDIPRKAKRKTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDK
RRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDTEDIPYV
Sequence length 227
Interactions View interactions

No strongly related genes found yet for TCEAL2.

No additional diseases found yet through genes similar to TCEAL2.