Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	374403
Gene name	TBC1 domain family member 10C
Gene symbol	TBC1D10C
Synonyms (NCBI Gene)	CARABINEPI64C
Chromosome	11
Chromosome location	11q13.2
Summary	The protein encoded by this gene has an N-terminal Rab-GTPase domain and a binding site at the C-terminus for calcineurin, and is an inhibitor of both the Ras signaling pathway and calcineurin, a phosphatase regulated by calcium and calmodulin. Genes enco

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	17562788
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0031527	Component	Filopodium membrane	IDA	17562788
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0042113	Process	B cell activation	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IMP	17562788
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070885	Process	Negative regulation of calcineurin-NFAT signaling cascade	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1902017	Process	Regulation of cilium assembly	IMP	17646400

MIM	HGNC	e!Ensembl
610831	24702	ENSG00000175463

Q8IV04

Protein name

Carabin (TBC1 domain family member 10C)

Protein function

Inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. Acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras. {ECO:0000

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00566	RabGAP-TBC	95 → 295	Rab-GTPase-TBC domain	Family

Tissue specificity

TISSUE SPECIFICITY: Most abundant in spleen and peripheral blood leukocytes. {ECO:0000269|PubMed:17230191}.

Sequence

MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLI
RQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQ
ELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQ
GPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPHVHKH
LQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLALGTAE
QRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQLAQLPDSAPGP
PPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLL
TRARGPPIEGPPRPQRGSTSFLDTRF

Sequence length

446

Interactions

View interactions

Reactome Pathway
Neutrophil degranulation
TBC/RABGAPs

Related Genes Genes most often co-reported with TBC1D10C across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TBC1D10C.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TBC1D10C (see Related Genes above), that are NOT already directly curated for TBC1D10C itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TBC1D10C.

TBC1D10C (TBC1 domain family member 10C)

Bookmark This Gene