Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	353164
Gene name	Taste 2 receptor member 42
Gene symbol	TAS2R42
Synonyms (NCBI Gene)	T2R24T2R42T2R55TAS2R55
Chromosome	12
Chromosome location	12p13.2

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	20022913
GO:0016020	Component	Membrane	IEA
GO:0033038	Function	Bitter taste receptor activity	IDA	20022913
GO:0050909	Process	Sensory perception of taste	IEA

MIM	HGNC	e!Ensembl
613966	18888	ENSG00000186136

Q7RTR8

Protein name

Taste receptor type 2 member 42 (T2R42) (Taste receptor type 2 member 55) (T2R55)

Protein function

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05296	TAS2R	1 → 303	Taste receptor protein (TAS2R)	Family

Sequence

MATELDKIFLILAIAEFIISMLGNVFIGLVNCSEGIKNQKVFSADFILTCLAISTIGQLL
VILFDSFLVGLASHLYTTYRLGKTVIMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSLFL
WLRWRMNGMIVMLLILSLFLLIFDSLVLEIFIDISLNIIDKSNLTLYLDESKTLYDKLSI
LKTLLSLTSFIPFSLFLTSLLFLFLSLVRHTRNLKLSSLGSRDSSTEAHRRAMKMVMSFL
FLFIVHFFSLQVANGIFFMLWNNKYIKFVMLALNAFPSCHSFILILGNSKLRQTAVRLLW
HLRNYTKTPNALPL

Sequence length

314

Interactions

View interactions

KEGG Pathway
Taste transduction

Related Genes Genes most often co-reported with TAS2R42 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for TAS2R42.

Diseases Linked via Similar Genes Diseases curated for genes most similar to TAS2R42 (see Related Genes above), that are NOT already directly curated for TAS2R42 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to TAS2R42.

TAS2R42 (taste 2 receptor member 42)

Bookmark This Gene