TAS2R36 (taste 2 receptor member 36)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 266666
Gene name Taste 2 receptor member 36
Gene symbol TAS2R36
Synonyms (NCBI Gene)
T2R36
Chromosome 12
Chromosome location -
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IEA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
GO:0007186 Process G protein-coupled receptor signaling pathway IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 19115 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DTE0
Protein name Putative taste receptor type 2 member 36 (T2R36) (hGR36)
Protein function Putative taste receptor which may play a role in the perception of bitterness.
Family and domains
Sequence 
MICFLLIILSILVVFAFVLGNFSNGFIALVNVIDWVKRQKISSADQILTALVVSRVGLLW
VILLHWYSNVLNSALYSSEVIIFISNAWAIINHFSIWLATSLSIFYLLKIVNFSRLIFHH
LKRKAKSVVLVIVLGPLVFLVCHLVMKHTYINVWTKEYEGNVTWKIKLRNAIHLSNLTVS
TLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAI
YFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVFWQMRYW
VKGEKPSSP
Sequence length 309
Interactions View interactions

No strongly related genes found yet for TAS2R36.

No additional diseases found yet through genes similar to TAS2R36.