TAS2R33 (taste 2 receptor member 33)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 266665
Gene name Taste 2 receptor member 33
Gene symbol TAS2R33
Synonyms (NCBI Gene)
T2R33
Chromosome 12
Chromosome location -
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IEA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
GO:0007186 Process G protein-coupled receptor signaling pathway IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 19114 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DSN6
Protein name Putative taste receptor type 2 member 33 (T2R33) (hGR33)
Protein function Putative taste receptor which may play a role in the perception of bitterness.
Family and domains
Sequence 
MVYFLPIIFSILVVFAFVLGNFSNGFIALVNVIDWVKRQKISSADQILTALVVSRVGLLW
VILLHWYANVFNSALYSLEVRIVASNISAVINHFSIWLAASLSIFYLLKIANFSNLIFLH
LKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVT
TLANLIPFTLSLICFLLLICSLCKHLKKMQLHSKGSQDPSTKVHIKALQTVISFLMLCAI
YFLSIMISVWNLRSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQVRYW
VKGEKPSSP
Sequence length 309
Interactions View interactions

No strongly related genes found yet for TAS2R33.

No additional diseases found yet through genes similar to TAS2R33.