TAGLN3 (transgelin 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 29114
Gene name Transgelin 3
Gene symbol TAGLN3
Synonyms (NCBI Gene)
NP22NP24NP25
Chromosome 3
Chromosome location 3q13.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT030107 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005634 Component Nucleus IEA
GO:0007015 Process Actin filament organization IBA
GO:0007417 Process Central nervous system development TAS 8015377
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607953 29868 ENSG00000144834
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UI15
Protein name Transgelin-3 (Neuronal protein 22) (NP22) (Neuronal protein NP25)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00307 CH 24 → 138 Calponin homology (CH) domain Domain
PF00402 Calponin 174 → 198 Calponin family repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Widely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum.
Sequence 
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Sequence length 199
Interactions View interactions

No strongly related genes found yet for TAGLN3.

No additional diseases found yet through genes similar to TAGLN3.