TAFA3 (TAFA chemokine like family member 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 284467
Gene name TAFA chemokine like family member 3
Gene symbol TAFA3
Synonyms (NCBI Gene)
FAM19A3TAFA-3
Chromosome 1
Chromosome location 1p13.2
Summary This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IDA 25595455
GO:0005615 Component Extracellular space IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617497 21590 ENSG00000184599
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z5A8
Protein name Chemokine-like protein TAFA-3
Protein function Plays a role in the regulation of microglia polarization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12020 TAFA 43 → 131 TAFA family Family
Tissue specificity TISSUE SPECIFICITY: Brain-specific. {ECO:0000269|PubMed:15028294, ECO:0000269|PubMed:25595455}.
Sequence 
MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRI
EERSQTVKCSCFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSC
SSGHKVKTTKVTR
Sequence length 133
Interactions View interactions

No strongly related genes found yet for TAFA3.

No additional diseases found yet through genes similar to TAFA3.