TAF6L (TATA-box binding protein associated factor 6 like)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10629
• Gene name: TATA-box binding protein associated factor 6 like
• Gene symbol: TAF6L
• Synonyms (NCBI Gene): PAF65A
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020438	hsa-miR-106b-5p	Microarray	17242205

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	TAS	9674425
GO:0000124	Component	SAGA complex	IDA	11564863
GO:0000124	Component	SAGA complex	IEA
GO:0000124	Component	SAGA complex	NAS	9674425, 19114550
GO:0003677	Function	DNA binding	TAS	9674425
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	11564863
GO:0005515	Function	Protein binding	IPI	9674425, 16713569, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	11564863
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005669	Component	Transcription factor TFIID complex	IEA
GO:0006282	Process	Regulation of DNA repair	NAS	11564863
GO:0006338	Process	Chromatin remodeling	TAS	9674425
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	9674425
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IEA
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0046695	Component	SLIK (SAGA-like) complex	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:1904672	Process	Regulation of somatic stem cell population maintenance	ISS

Other IDs

• MIM: 602946
• HGNC: 17305
• e!Ensembl: ENSG00000162227

Protein

• UniProt ID: Q9Y6J9
• Protein name: TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L (TAF6L) (PCAF-associated factor 65-alpha) (PAF65-alpha)
• Protein function: Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex (Probable). With TAF5L, a
• PDB: 7KTR , 7KTS , 8H7G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02969	TAF	9 → 73	TATA box binding protein associated factor (TAF)	Domain
  PF07571	TAF6_C	220 → 331	TAF6 C-terminal HEAT repeat domain	Family

• Sequence:

  MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKR
  RKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPK
  GCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKVAL
  QDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPHLCLGPYVRCLVG
  SVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADP
  VRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYG
  AILVAVERLLKMKAQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLP
  LPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPD
  SVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPG
  TGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPM
  IGRTSRPARRWALSDYSLYLPL

• Sequence length: 622

Pathways

KEGG Pathway:

Basal transcription factors

Related Genes

No strongly related genes found yet for TAF6L.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TAF6L.