TAC4 (tachykinin precursor 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 255061
Gene name Tachykinin precursor 4
Gene symbol TAC4
Synonyms (NCBI Gene)
EKHK-1HK1PPT-C
Chromosome 17
Chromosome location 17q21.33
Summary This gene is a member of the tachykinin family of neurotransmitter-encoding genes. Tachykinin proteins are cleaved into small, secreted peptides that activate members of a family of receptor proteins. The products of this gene preferentially activate tach
miRNA miRNA information provided by mirtarbase database.
15 Show/Hide all (15)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018127 hsa-miR-335-5p Microarray 18185580
MIRT1408257 hsa-miR-1224-5p CLIP-seq
MIRT1408258 hsa-miR-1253 CLIP-seq
MIRT1408259 hsa-miR-3919 CLIP-seq
MIRT1408260 hsa-miR-4318 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19 Show/Hide all (19)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003085 Process Negative regulation of systemic arterial blood pressure IDA 12716968
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IDA 17101218, 17437961, 17655832
GO:0006954 Process Inflammatory response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607833 16641 ENSG00000176358
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86UU9
Protein name Tachykinin-4 (Preprotachykinin-C) (PPT-C) [Cleaved into: Endokinin-A (EKA); Endokinin-A/B (EKA/B); Endokinin-C (EKC)]
Protein function Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Endokinin-A induces thermal hyperalgesia and pain-related beh
PDB 2MOC
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at low levels in the uterus of both pregnant and non-pregnant women. Isoform 1 is found only in the adrenal gland and fetal liver. Isoform 2 is found in heart, liver, bone marrow, prostate, adrenal gland and testis. Isoform 3
Sequence 
MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKA
SQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE
Sequence length 113
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Neuroactive ligand-receptor interaction
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Familial cancer of breast Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Melanoma Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (173)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 29689546
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma CTD_human_DG 27602772
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 29689546
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 27721436
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Anemia Pubtator 19651813 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Anemia BEFREE 19903819
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Hemolytic Hemolytic anemia Pubtator 4980929 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Hemolytic Congenital Hemolytic anemia Pubtator 4027385 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Hemolytic Congenital Nonspherocytic Hemolytic anemia Pubtator 12393545, 19651813, 30778173, 4027385, 618553, 9197463 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia, Hemolytic Anemia BEFREE 12023819
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for TAC4.

No additional diseases found yet through genes similar to TAC4.