TAAR3P (trace amine associated receptor 3, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 9288
Gene name Trace amine associated receptor 3, pseudogene
Gene symbol TAAR3P
Synonyms (NCBI Gene)
GPR57GPR58TAAR2TAAR3
Chromosome 6
Chromosome location 6q23.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001594 Function Trace-amine receptor activity IBA
GO:0001594 Function Trace-amine receptor activity IEA
GO:0001594 Function Trace-amine receptor activity ISS
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 10684976
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P1P4
Protein name Putative trace amine-associated receptor 3 (TaR-3) (Trace amine receptor 3) (hTaar3) (G-protein coupled receptor 57)
Protein function Putative olfactory receptor activated by several primary trace amines.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 48 → 309 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Not expressed in the pons, thalamus, globus pallidus, caudate, putamen or cerebellum. {ECO:0000269|PubMed:10684976}.
Sequence 
MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFK
QLHSPTNFLILSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIF
HLCSIAIDRFYAVCYPLHYTTKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYK
ILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSKQHARVISHVPENTKG
AVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPILILDLLVWLRYF
NSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH
Sequence length 343
Interactions View interactions

No strongly related genes found yet for TAAR3P.

No additional diseases found yet through genes similar to TAAR3P.