SYT14P1 (synaptotagmin 14 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401135
Gene name Synaptotagmin 14 pseudogene 1
Gene symbol SYT14P1
Synonyms (NCBI Gene)
CHR415SYTSYT14LSYTDEP
Chromosome 4
Chromosome location 4q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005543 Function Phospholipid binding IBA
GO:0030154 Process Cell differentiation IEA
GO:0032793 Process Positive regulation of CREB transcription factor activity IMP 23999003
GO:0070374 Process Positive regulation of ERK1 and ERK2 cascade IMP 23999003
GO:1903861 Process Positive regulation of dendrite extension IMP 23999003
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610892 33429 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q58G82
Protein name Putative synaptotagmin-14-like protein (Synaptotagmin XIV protein pseudogene 1) (Synaptotagmin XIV-derived protein) (Synaptotagmin XIV-like protein)
Protein function Plays a role in melanocyte differentiation; enhances dendrite outgrowth, melanin content and tyrosinase activity through the modulation of ERK and/or CREB pathways (PubMed:23999003).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 64 → 170 C2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in mature peripheral blood neutrophils (at protein level) (PubMed:16376304). Expressed in heart, pancreas, liver and skeletal muscle (PubMed:11543631). Expressed in umbilical vein endothelial cells and melanocytes (PubMed:239
Sequence 
MLEGFQILVQNTVQGTIHKIKCVCDSQMSVSEMSCSESTSACQSLEDGSVPEILISLLYN
ATNGRLSAEVIKGSHLKNWAANRPPNTYVKLTLRKSTDQEMSKCKISIRRGRPNPVYKET
FVFKVTLFQLSHVTLMLSVYNKSSMRRKMIGWIYLGLNSSGEELNHWTEMKESKGRQVRR
WQALLESR
Sequence length 188
Interactions View interactions

No strongly related genes found yet for SYT14P1.

No additional diseases found yet through genes similar to SYT14P1.