SYNGR4 (synaptogyrin 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 23546
Gene name Synaptogyrin 4
Gene symbol SYNGR4
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.33
Summary This gene encodes an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear. [provided by RefSeq, Jul 200
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
GO:0030672 Component Synaptic vesicle membrane IBA
GO:0031594 Component Neuromuscular junction IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608373 11502 ENSG00000105467
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95473
Protein name Synaptogyrin-4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01284 MARVEL 18 → 163 Membrane-associating domain Domain
Sequence 
MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKMESPQLHCILN
SNSVACSFAVGAGFLAFLSCLAFLVLDTQETRIAGTRFKTAFQLLDFILAVLWAVVWFMG
FCFLANQWQHSPPKEFLLGSSSAQAAIAFTFFSILVWIFQAYLAFQDLRNDAPVPYKRFL
DEGGMVLTTLPLPSANSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN
Sequence length 234
Interactions View interactions

No strongly related genes found yet for SYNGR4.

No additional diseases found yet through genes similar to SYNGR4.