SYNGR3 (synaptogyrin 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 9143
• Gene name: Synaptogyrin 3
• Gene symbol: SYNGR3
• Synonyms (NCBI Gene): -
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This gene encodes an integral membrane protein. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it is a synaptic vesicle protein that also interacts with the dopamine transporter. The gene product belong

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016883	hsa-miR-335-5p	Microarray	18185580
MIRT1406076	hsa-miR-1321	CLIP-seq
MIRT1406077	hsa-miR-217	CLIP-seq
MIRT1406078	hsa-miR-3925-3p	CLIP-seq
MIRT1406079	hsa-miR-4419a	CLIP-seq
MIRT1406080	hsa-miR-4510	CLIP-seq
MIRT1406081	hsa-miR-4739	CLIP-seq
MIRT1406082	hsa-miR-4756-5p	CLIP-seq
MIRT1406083	hsa-miR-520a-5p	CLIP-seq
MIRT1406084	hsa-miR-525-5p	CLIP-seq
MIRT1406085	hsa-miR-766	CLIP-seq
MIRT2121746	hsa-miR-1976	CLIP-seq
MIRT2121747	hsa-miR-3145-5p	CLIP-seq
MIRT2121748	hsa-miR-431	CLIP-seq
MIRT2121749	hsa-miR-490-3p	CLIP-seq
MIRT2343725	hsa-miR-1285	CLIP-seq
MIRT2343726	hsa-miR-1343	CLIP-seq
MIRT2343727	hsa-miR-2355-3p	CLIP-seq
MIRT2343728	hsa-miR-3130-3p	CLIP-seq
MIRT2343729	hsa-miR-3187-5p	CLIP-seq
MIRT2343730	hsa-miR-326	CLIP-seq
MIRT2343731	hsa-miR-330-5p	CLIP-seq
MIRT2343732	hsa-miR-3622a-3p	CLIP-seq
MIRT2343733	hsa-miR-3622b-3p	CLIP-seq
MIRT2343734	hsa-miR-4435	CLIP-seq
MIRT2343735	hsa-miR-4646-3p	CLIP-seq
MIRT2343736	hsa-miR-4704-3p	CLIP-seq
MIRT2343737	hsa-miR-601	CLIP-seq
MIRT2343738	hsa-miR-612	CLIP-seq
MIRT2343739	hsa-miR-645	CLIP-seq
MIRT2343740	hsa-miR-676	CLIP-seq
MIRT2395459	hsa-miR-3126-5p	CLIP-seq
MIRT2395460	hsa-miR-4640-5p	CLIP-seq
MIRT2395461	hsa-miR-4726-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008021	Component	Synaptic vesicle	ISS
GO:0010807	Process	Regulation of synaptic vesicle priming	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9760194
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031594	Component	Neuromuscular junction	IBA
GO:0031594	Component	Neuromuscular junction	IEA
GO:0032411	Process	Positive regulation of transporter activity	ISS
GO:0042169	Function	SH2 domain binding	IEA
GO:0045055	Process	Regulated exocytosis	IEA
GO:0045055	Process	Regulated exocytosis	ISS
GO:0045202	Component	Synapse	IEA
GO:0051580	Process	Regulation of neurotransmitter uptake	IEA

Other IDs

• MIM: 603927
• HGNC: 11501
• e!Ensembl: ENSG00000127561

Protein

• UniProt ID: O43761
• Protein name: Synaptogyrin-3
• Protein function: May play a role in regulated exocytosis. May indirectly regulate the activity of the plasma membrane dopamine transporter SLC6A3 and thereby regulate dopamine transport back from the synaptic cleft into the presynaptic terminal. {ECO:0000250|Uni
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01284	MARVEL	20 → 166	Membrane-associating domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and placenta. {ECO:0000269|PubMed:9760194}.
• Sequence:

  MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCV
  FNGNAGACRFGVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWF
  VGFCFLTNQWQRTAPGPATTQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLF
  ATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVPAY

• Sequence length: 229

Related Genes

No strongly related genes found yet for SYNGR3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SYNGR3.