SURF2 (surfeit 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 6835
Gene name Surfeit 2
Gene symbol SURF2
Synonyms (NCBI Gene)
SURF-2
Chromosome 9
Chromosome location 9q34.2
Summary This gene shares a bidirectional promoter with surfeit 1 (SURF1; GeneID: 6834), which is located on the opposite strand. It encodes a conserved protein that is expressed in a variety of tissues. [provided by RefSeq, Jul 2013]
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT041981 hsa-miR-484 CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Download as csvDownload as pdf
Transcription factor Regulation Reference
MYC Activation 10858544
YY1 Activation 10858544;7607503
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21900206, 28514442, 33961781, 35271311
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
GO:0005886 Component Plasma membrane IDA
GO:0016607 Component Nuclear speck IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
185630 11475 ENSG00000148291
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15527
Protein name Surfeit locus protein 2 (Surf-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05477 SURF2 5 → 245 Surfeit locus protein 2 (SURF2) Family
Sequence 
MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASP
AFDYAEFEPHIVPSTKNPHQLFCKLTLRHINKCPEHVLRHTQGRRYQRALCKYEECQKQG
VEYVPACLVHRRRRREDQMDGDGPRPREAFWEPTSSDEGGAASDDSMTDLYPPELFTRKD
LGSTEDGDGTDDFLTDKEDEKAKPPREKATDESRRETTVYRGLVQKRGKKQLGSLKKKFK
SHHRKPKSFSSCKQPG
Sequence length 256
Interactions View interactions

No strongly related genes found yet for SURF2.

No additional diseases found yet through genes similar to SURF2.