SUMO1P1 (SUMO1 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 391257
Gene name SUMO1 pseudogene 1
Gene symbol SUMO1P1
Synonyms (NCBI Gene)
PIC1LUBL2UBL6
Chromosome 20
Chromosome location 20q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 25910212, 26871637, 27211601
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 27211601
GO:0005634 Component Nucleus IEA
GO:0008134 Function Transcription factor binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 33148 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
G2XKQ0
Protein name Small ubiquitin-related modifier 5 (SUMO-5) (SUMO1 pseudogene 1) (Ubiquitin-like 2) (Ubiquitin-like 6)
Protein function Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Regulates the life cycle of promyelocytic leukemia nuclear bodies (PML-NBs). PolySUMO1P1/SUMO5 conjugation on 'Lys-160' of PML facilit
PDB 6IAM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11976 Rad60-SLD 22 → 92 Ubiquitin-2 like Rad60 SUMO-like Family
Tissue specificity TISSUE SPECIFICITY: High expression levels in testes and peripheral blood leukocyte (PubMed:27211601). Expressed also in lung, placenta, liver, spleen and thymus (PubMed:27211601). {ECO:0000269|PubMed:27211601}.
Sequence 
MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVN
SLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGGHSTV
Sequence length 101
Interactions View interactions

No strongly related genes found yet for SUMO1P1.

No additional diseases found yet through genes similar to SUMO1P1.