STYXL1 (serine/threonine/tyrosine interacting like 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51657
• Gene name: Serine/threonine/tyrosine interacting like 1
• Gene symbol: STYXL1
• Synonyms (NCBI Gene): DUSP24, MK-STYX, MKSTYX
• Chromosome: 7
• Chromosome location: 7q11.23

miRNA Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1402109	hsa-miR-125a-3p	CLIP-seq
MIRT1402110	hsa-miR-1291	CLIP-seq
MIRT1402111	hsa-miR-3176	CLIP-seq
MIRT1402112	hsa-miR-328	CLIP-seq
MIRT1402113	hsa-miR-329	CLIP-seq
MIRT1402114	hsa-miR-361-3p	CLIP-seq
MIRT1402115	hsa-miR-362-3p	CLIP-seq
MIRT1402116	hsa-miR-365	CLIP-seq
MIRT1402117	hsa-miR-3922-3p	CLIP-seq
MIRT1402118	hsa-miR-3941	CLIP-seq
MIRT1402119	hsa-miR-4290	CLIP-seq
MIRT1402120	hsa-miR-4313	CLIP-seq
MIRT1402121	hsa-miR-4698	CLIP-seq
MIRT1402122	hsa-miR-4726-3p	CLIP-seq
MIRT1402123	hsa-miR-4789-5p	CLIP-seq
MIRT1402124	hsa-miR-603	CLIP-seq
MIRT1402125	hsa-miR-661	CLIP-seq
MIRT1402116	hsa-miR-365	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001691	Function	Pseudophosphatase activity	IBA
GO:0001691	Function	Pseudophosphatase activity	IMP	20180778, 23163895
GO:0005515	Function	Protein binding	IPI	19026618, 20180778
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	21262771
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	29250526
GO:0019212	Function	Phosphatase inhibitor activity	IDA	24709986
GO:0019903	Function	Protein phosphatase binding	IBA
GO:0019903	Function	Protein phosphatase binding	IPI	24709986
GO:0035556	Process	Intracellular signal transduction	TAS	9757831
GO:0062030	Process	Negative regulation of stress granule assembly	IBA
GO:0062030	Process	Negative regulation of stress granule assembly	IMP	20180778, 23163895
GO:2001242	Process	Regulation of intrinsic apoptotic signaling pathway	IGI	24709986
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IBA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21262771, 24709986

Other IDs

• MIM: 616695
• HGNC: 18165
• e!Ensembl: ENSG00000127952

Protein

• UniProt ID: Q9Y6J8
• Protein name: Serine/threonine/tyrosine-interacting-like protein 1 (Dual specificity phosphatase inhibitor MK-STYX) (Dual specificity protein phosphatase 24) (Inactive dual specificity protein phosphatase MK-STYX) (Map kinase phosphatase-like protein MK-STYX)
• Protein function: Catalytically inactive phosphatase (PubMed:20180778, PubMed:23163895). By binding to G3BP1, inhibits the formation of G3BP1-induced stress granules (PubMed:20180778, PubMed:23163895). Does not act by protecting the dephosphorylation of G3BP1 at
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00581	Rhodanese	9 → 137	Rhodanese-like domain	Domain
  PF00782	DSPc	168 → 299	Dual specificity phosphatase, catalytic domain	Domain

• Sequence:

  MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEY
  LLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLT
  HHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPK
  IQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGS
  VILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTI
  LGDSITNIMDPLY

• Sequence length: 313

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
STYXL1-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32271415	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36360783	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37679740	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31146910		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31146910		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31146910		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	38168070	Associate	★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	BEFREE	25724587, 30472486		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25326153		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for STYXL1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to STYXL1.