Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6811
Gene name	Syntaxin 5
Gene symbol	STX5
Synonyms (NCBI Gene)	CDG2AASED5STX5A
Chromosome	11
Chromosome location	11q12.3
Summary	This gene encodes a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for v-SNAREs (vesicle-SNAP receptors), permitting specific synaptic vesicle docking and fusion. The en

125 Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021024	hsa-miR-155-5p	Proteomics	18668040
MIRT1401051	hsa-miR-3163	CLIP-seq
MIRT1401052	hsa-miR-3681	CLIP-seq
MIRT1401053	hsa-miR-4261	CLIP-seq
MIRT1401054	hsa-miR-548c-3p	CLIP-seq
MIRT2120251	hsa-miR-3121-5p	CLIP-seq
MIRT2120252	hsa-miR-3122	CLIP-seq
MIRT2120253	hsa-miR-3135b	CLIP-seq
MIRT2120254	hsa-miR-3652	CLIP-seq
MIRT2120255	hsa-miR-3689a-3p	CLIP-seq
MIRT2120256	hsa-miR-3689c	CLIP-seq
MIRT2120257	hsa-miR-3913-5p	CLIP-seq
MIRT2120258	hsa-miR-3918	CLIP-seq
MIRT1401053	hsa-miR-4261	CLIP-seq
MIRT2120259	hsa-miR-4430	CLIP-seq
MIRT2120260	hsa-miR-4512	CLIP-seq
MIRT2120261	hsa-miR-4685-5p	CLIP-seq
MIRT2120262	hsa-miR-485-5p	CLIP-seq
MIRT2120263	hsa-miR-513a-5p	CLIP-seq
MIRT2120264	hsa-miR-516a-3p	CLIP-seq
MIRT2342273	hsa-miR-103a	CLIP-seq
MIRT2342274	hsa-miR-107	CLIP-seq
MIRT2342275	hsa-miR-10a	CLIP-seq
MIRT2342276	hsa-miR-10b	CLIP-seq
MIRT2342277	hsa-miR-1184	CLIP-seq
MIRT2342278	hsa-miR-1226	CLIP-seq
MIRT2342279	hsa-miR-1266	CLIP-seq
MIRT2342280	hsa-miR-1271	CLIP-seq
MIRT2342281	hsa-miR-182	CLIP-seq
MIRT2342282	hsa-miR-24	CLIP-seq
MIRT2342283	hsa-miR-3127-5p	CLIP-seq
MIRT2342284	hsa-miR-3179	CLIP-seq
MIRT2120255	hsa-miR-3689a-3p	CLIP-seq
MIRT2120256	hsa-miR-3689c	CLIP-seq
MIRT2120258	hsa-miR-3918	CLIP-seq
MIRT2342285	hsa-miR-4437	CLIP-seq
MIRT2342286	hsa-miR-4514	CLIP-seq
MIRT2342287	hsa-miR-4518	CLIP-seq
MIRT2342288	hsa-miR-4530	CLIP-seq
MIRT2342289	hsa-miR-4692	CLIP-seq
MIRT2342290	hsa-miR-4717-3p	CLIP-seq
MIRT2342291	hsa-miR-4733-3p	CLIP-seq
MIRT2120262	hsa-miR-485-5p	CLIP-seq
MIRT2342292	hsa-miR-548ad	CLIP-seq
MIRT2342293	hsa-miR-558	CLIP-seq
MIRT2342294	hsa-miR-627	CLIP-seq
MIRT2342295	hsa-miR-634	CLIP-seq
MIRT2342296	hsa-miR-96	CLIP-seq
MIRT2395387	hsa-miR-3125	CLIP-seq
MIRT2395388	hsa-miR-3916	CLIP-seq
MIRT2342290	hsa-miR-4717-3p	CLIP-seq
MIRT2395389	hsa-miR-583	CLIP-seq
MIRT1401051	hsa-miR-3163	CLIP-seq
MIRT2460761	hsa-miR-340	CLIP-seq
MIRT1401054	hsa-miR-548c-3p	CLIP-seq
MIRT2460762	hsa-miR-629	CLIP-seq
MIRT2342273	hsa-miR-103a	CLIP-seq
MIRT2342274	hsa-miR-107	CLIP-seq
MIRT2342277	hsa-miR-1184	CLIP-seq
MIRT2342278	hsa-miR-1226	CLIP-seq
MIRT2342280	hsa-miR-1271	CLIP-seq
MIRT2342281	hsa-miR-182	CLIP-seq
MIRT2636050	hsa-miR-185	CLIP-seq
MIRT2636051	hsa-miR-204	CLIP-seq
MIRT2636052	hsa-miR-211	CLIP-seq
MIRT2120251	hsa-miR-3121-5p	CLIP-seq
MIRT2120252	hsa-miR-3122	CLIP-seq
MIRT2120253	hsa-miR-3135b	CLIP-seq
MIRT1401051	hsa-miR-3163	CLIP-seq
MIRT2460761	hsa-miR-340	CLIP-seq
MIRT2120254	hsa-miR-3652	CLIP-seq
MIRT1401052	hsa-miR-3681	CLIP-seq
MIRT2120255	hsa-miR-3689a-3p	CLIP-seq
MIRT2120256	hsa-miR-3689c	CLIP-seq
MIRT2120257	hsa-miR-3913-5p	CLIP-seq
MIRT2636053	hsa-miR-4287	CLIP-seq
MIRT2636054	hsa-miR-4306	CLIP-seq
MIRT2636055	hsa-miR-431	CLIP-seq
MIRT2120259	hsa-miR-4430	CLIP-seq
MIRT2636056	hsa-miR-4469	CLIP-seq
MIRT2636057	hsa-miR-4476	CLIP-seq
MIRT2342288	hsa-miR-4530	CLIP-seq
MIRT2636058	hsa-miR-4644	CLIP-seq
MIRT2636059	hsa-miR-4645-3p	CLIP-seq
MIRT2636060	hsa-miR-4685-3p	CLIP-seq
MIRT2636061	hsa-miR-4718	CLIP-seq
MIRT2342291	hsa-miR-4733-3p	CLIP-seq
MIRT2636062	hsa-miR-4761-3p	CLIP-seq
MIRT2120262	hsa-miR-485-5p	CLIP-seq
MIRT2120263	hsa-miR-513a-5p	CLIP-seq
MIRT2120264	hsa-miR-516a-3p	CLIP-seq
MIRT2342292	hsa-miR-548ad	CLIP-seq
MIRT1401054	hsa-miR-548c-3p	CLIP-seq
MIRT2636063	hsa-miR-555	CLIP-seq
MIRT2342293	hsa-miR-558	CLIP-seq
MIRT2342294	hsa-miR-627	CLIP-seq
MIRT2460762	hsa-miR-629	CLIP-seq
MIRT2342295	hsa-miR-634	CLIP-seq
MIRT2342296	hsa-miR-96	CLIP-seq
MIRT2636050	hsa-miR-185	CLIP-seq
MIRT2636051	hsa-miR-204	CLIP-seq
MIRT2636052	hsa-miR-211	CLIP-seq
MIRT2120251	hsa-miR-3121-5p	CLIP-seq
MIRT2120252	hsa-miR-3122	CLIP-seq
MIRT2120253	hsa-miR-3135b	CLIP-seq
MIRT1401051	hsa-miR-3163	CLIP-seq
MIRT2460761	hsa-miR-340	CLIP-seq
MIRT2120254	hsa-miR-3652	CLIP-seq
MIRT2120255	hsa-miR-3689a-3p	CLIP-seq
MIRT2120256	hsa-miR-3689c	CLIP-seq
MIRT2120257	hsa-miR-3913-5p	CLIP-seq
MIRT2636053	hsa-miR-4287	CLIP-seq
MIRT2636054	hsa-miR-4306	CLIP-seq
MIRT2120259	hsa-miR-4430	CLIP-seq
MIRT2636056	hsa-miR-4469	CLIP-seq
MIRT2636057	hsa-miR-4476	CLIP-seq
MIRT2636058	hsa-miR-4644	CLIP-seq
MIRT2636060	hsa-miR-4685-3p	CLIP-seq
MIRT2636062	hsa-miR-4761-3p	CLIP-seq
MIRT2120262	hsa-miR-485-5p	CLIP-seq
MIRT2120263	hsa-miR-513a-5p	CLIP-seq
MIRT2120264	hsa-miR-516a-3p	CLIP-seq
MIRT1401054	hsa-miR-548c-3p	CLIP-seq
MIRT2636063	hsa-miR-555	CLIP-seq
MIRT2460762	hsa-miR-629	CLIP-seq

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000149	Function	SNARE binding	IBA
GO:0005484	Function	SNAP receptor activity	IBA
GO:0005484	Function	SNAP receptor activity	IDA	15215310
GO:0005484	Function	SNAP receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 18167358, 18843296, 19536132, 22153078, 25416956, 25910212, 30833792, 32296183, 32814053, 33961781, 34711829, 34779586, 35271311
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IDA	9464276, 15215310, 16081076
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	34711829
GO:0006906	Process	Vesicle fusion	IBA
GO:0012505	Component	Endomembrane system	IBA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0031201	Component	SNARE complex	IBA
GO:0031201	Component	SNARE complex	TAS	15215310
GO:0031982	Component	Vesicle	IDA	16081076
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0034498	Process	Early endosome to Golgi transport	IMP	17389686
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	15215310
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	21242315
GO:0048278	Process	Vesicle docking	IBA
GO:0090166	Process	Golgi disassembly	IDA	16081076
GO:0098588	Component	Bounding membrane of organelle	IEA
GO:1903358	Process	Regulation of Golgi organization	IDA	16081076

MIM	HGNC	e!Ensembl
603189	11440	ENSG00000162236

Q13190

Protein name

Syntaxin-5

Protein function

Mediates endoplasmic reticulum to Golgi transport. Together with p115/USO1 and GM130/GOLGA2, involved in vesicle tethering and fusion at the cis-Golgi membrane to maintain the stacked and inter-connected structure of the Golgi apparatus. {ECO:00

PDB

3EFO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05739	SNARE	299 → 351	SNARE domain	Family
PF11416	Syntaxin-5_N	52 → 74	Syntaxin-5 N-terminal, Sly1p-binding domain	Family

Sequence

MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDR
TQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHAS
KDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA

Sequence length

355

Interactions

View interactions

KEGG Pathway	Reactome Pathway
SNARE interactions in vesicular transport	COPII-mediated vesicle transport
	Cargo concentration in the ER
	COPI-mediated anterograde transport
	Intra-Golgi traffic
	Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGENITAL DISORDER OF GLYCOSYLATION	—	Disgenet	34711829	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDER OF GLYCOSYLATION TYPE II	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDER OF GLYCOSYLATION TYPE IIAA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIAA	—	ClinVar, GenCC, HPO ClinVar, GenCC, HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Asthma	Asthma	Pubtator	31952466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19754436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27485360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27485360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31357511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	28041965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia Tarda, X-Linked	Spondyloenchondrodysplasia	BEFREE	23898804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unverricht-Lundborg Syndrome	Myoclonic Epilepsy	BEFREE	28982678		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GET4	1	["Congenital disorder of glycosylation"]	0	[]	4	["GenCC (Congenital disorder of glycosylation)","ClinVar (Congenital disorder of glycosylation)","Disgenet (Congenital disorder of glycosylation)","HPO (Congenital disorder of glycosylation)"]
COG3	1	["Congenital disorder of glycosylation"]	2	["COPI-mediated anterograde transport","Intra-Golgi traffic"]	4	["GenCC (Congenital disorder of glycosylation)","ClinVar (Congenital disorder of glycosylation)","Disgenet (Congenital disorder of glycosylation)","HPO (Congenital disorder of glycosylation)"]
COG7	1	["Congenital disorder of glycosylation"]	2	["COPI-mediated anterograde transport","Intra-Golgi traffic"]	4	["GenCC (Congenital disorder of glycosylation)","ClinVar (Congenital disorder of glycosylation)","Disgenet (Congenital disorder of glycosylation)","HPO (Congenital disorder of glycosylation)"]
CAMLG	1	["Congenital disorder of glycosylation"]	0	[]	4	["GenCC (Congenital disorder of glycosylation)","ClinVar (Congenital disorder of glycosylation)","Disgenet (Congenital disorder of glycosylation)","HPO (Congenital disorder of glycosylation)"]
COG1	1	["Congenital disorder of glycosylation"]	2	["COPI-mediated anterograde transport","Intra-Golgi traffic"]	4	["GenCC (Congenital disorder of glycosylation)","ClinVar (Congenital disorder of glycosylation)","Disgenet (Congenital disorder of glycosylation)","HPO (Congenital disorder of glycosylation)"]

STX5 (syntaxin 5)

Bookmark This Gene