Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	346673
Gene name	Stimulated by retinoic acid 8
Gene symbol	STRA8
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q33
Summary	This gene encodes a retinoic acid-responsive protein. A homologous protein in mouse has been shown to be involved in the regulation of meiotic initiation in both spermatogenesis and oogenesis, though feature differences between the mouse and human protein

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22899867
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006260	Process	DNA replication	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048477	Process	Oogenesis	IBA
GO:0048477	Process	Oogenesis	IEA
GO:0048477	Process	Oogenesis	ISS
GO:0051321	Process	Meiotic cell cycle	IBA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051321	Process	Meiotic cell cycle	ISS
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0090427	Process	Activation of meiosis	IBA
GO:0090427	Process	Activation of meiosis	ISS

MIM	HGNC	e!Ensembl
609987	30653	ENSG00000146857

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q7Z7C7
Protein name	Stimulated by retinoic acid gene 8 protein homolog
Protein function	Meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, acts downstream of ZGLP1 as a key effector of the meiotic program: required for premeiotic DNA replication and subsequent events
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed specifically in testis and fetal ovaries. {ECO:0000269\|PubMed:12489526, ECO:0000269\|PubMed:26742488}.
Sequence	MGKIDVDKILFFNQEIRLWQLIMATPEENSNPHDRATPQLPAQLQELEHRVARRRLSQAR HRATLAALFNNLRKTVYSQSDLIASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGH ASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAA ISHLWQNLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVS TPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCA NTQVKQEASFPVDEEMIMLQCTETFDDEDL
Sequence length	330
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	CTD	32719396	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Azoospermia	Azoospermia	BEFREE	23320086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	23320086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	31253359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	37867192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	23320086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	30102701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	30106128		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with STRA8 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for STRA8.

Diseases Linked via Similar Genes Diseases curated for genes most similar to STRA8 (see Related Genes above), that are NOT already directly curated for STRA8 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to STRA8.

STRA8 (stimulated by retinoic acid 8)

Save This Analysis