Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6788
Gene name	Serine/threonine kinase 3
Gene symbol	STK3
Synonyms (NCBI Gene)	KRS1MST2
Chromosome	8
Chromosome location	8q22.2
Summary	This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal p

231 Show/Hide all (231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001813	hsa-miR-141-3p	Luciferase reporter assay	15131085
MIRT021330	hsa-miR-9-5p	Microarray	17612493
MIRT001813	hsa-miR-141-3p	Reporter assay;Other	15131085
MIRT021938	hsa-miR-128-3p	Microarray	17612493
MIRT024880	hsa-miR-215-5p	Microarray	19074876
MIRT026447	hsa-miR-192-5p	Microarray	19074876
MIRT052938	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	22179829
MIRT052938	hsa-miR-133b	ImmunoblotLuciferase reporter assayMicroarray	22179829
MIRT1397628	hsa-miR-1	CLIP-seq
MIRT1397629	hsa-miR-1279	CLIP-seq
MIRT1397630	hsa-miR-129-3p	CLIP-seq
MIRT1397631	hsa-miR-129-5p	CLIP-seq
MIRT1397632	hsa-miR-137	CLIP-seq
MIRT1397633	hsa-miR-141	CLIP-seq
MIRT1397634	hsa-miR-148a	CLIP-seq
MIRT1397635	hsa-miR-148b	CLIP-seq
MIRT1397636	hsa-miR-152	CLIP-seq
MIRT1397637	hsa-miR-194	CLIP-seq
MIRT1397638	hsa-miR-19a	CLIP-seq
MIRT1397639	hsa-miR-19b	CLIP-seq
MIRT1397640	hsa-miR-200a	CLIP-seq
MIRT1397641	hsa-miR-206	CLIP-seq
MIRT1397642	hsa-miR-21	CLIP-seq
MIRT1397643	hsa-miR-2113	CLIP-seq
MIRT1397644	hsa-miR-298	CLIP-seq
MIRT1397645	hsa-miR-3158-5p	CLIP-seq
MIRT1397646	hsa-miR-3162-3p	CLIP-seq
MIRT1397647	hsa-miR-3187-3p	CLIP-seq
MIRT1397648	hsa-miR-3668	CLIP-seq
MIRT1397649	hsa-miR-3690	CLIP-seq
MIRT1397650	hsa-miR-3941	CLIP-seq
MIRT1397651	hsa-miR-3977	CLIP-seq
MIRT1397652	hsa-miR-412	CLIP-seq
MIRT1397653	hsa-miR-4254	CLIP-seq
MIRT1397654	hsa-miR-4276	CLIP-seq
MIRT1397655	hsa-miR-4277	CLIP-seq
MIRT1397656	hsa-miR-4426	CLIP-seq
MIRT1397657	hsa-miR-4517	CLIP-seq
MIRT1397658	hsa-miR-4529-5p	CLIP-seq
MIRT1397659	hsa-miR-4643	CLIP-seq
MIRT1397660	hsa-miR-4647	CLIP-seq
MIRT1397661	hsa-miR-466	CLIP-seq
MIRT1397662	hsa-miR-4662b	CLIP-seq
MIRT1397663	hsa-miR-4672	CLIP-seq
MIRT1397664	hsa-miR-4694-3p	CLIP-seq
MIRT1397665	hsa-miR-4708-3p	CLIP-seq
MIRT1397666	hsa-miR-4718	CLIP-seq
MIRT1397667	hsa-miR-4724-3p	CLIP-seq
MIRT1397668	hsa-miR-4725-5p	CLIP-seq
MIRT1397669	hsa-miR-4789-3p	CLIP-seq
MIRT1397670	hsa-miR-4803	CLIP-seq
MIRT1397671	hsa-miR-504	CLIP-seq
MIRT1397672	hsa-miR-511	CLIP-seq
MIRT1397673	hsa-miR-512-3p	CLIP-seq
MIRT1397674	hsa-miR-548ae	CLIP-seq
MIRT1397675	hsa-miR-548aj	CLIP-seq
MIRT1397676	hsa-miR-548am	CLIP-seq
MIRT1397677	hsa-miR-548l	CLIP-seq
MIRT1397678	hsa-miR-548x	CLIP-seq
MIRT1397679	hsa-miR-590-5p	CLIP-seq
MIRT1397680	hsa-miR-613	CLIP-seq
MIRT1397681	hsa-miR-875-3p	CLIP-seq
MIRT1397682	hsa-miR-889	CLIP-seq
MIRT1397683	hsa-miR-944	CLIP-seq
MIRT1397629	hsa-miR-1279	CLIP-seq
MIRT1397633	hsa-miR-141	CLIP-seq
MIRT2341362	hsa-miR-1914	CLIP-seq
MIRT1397640	hsa-miR-200a	CLIP-seq
MIRT1397642	hsa-miR-21	CLIP-seq
MIRT2341363	hsa-miR-3121-3p	CLIP-seq
MIRT2341364	hsa-miR-3122	CLIP-seq
MIRT1397647	hsa-miR-3187-3p	CLIP-seq
MIRT2341365	hsa-miR-338-5p	CLIP-seq
MIRT2341366	hsa-miR-3646	CLIP-seq
MIRT1397648	hsa-miR-3668	CLIP-seq
MIRT2341367	hsa-miR-376a	CLIP-seq
MIRT2341368	hsa-miR-376b	CLIP-seq
MIRT2341369	hsa-miR-3913-5p	CLIP-seq
MIRT2341370	hsa-miR-3936	CLIP-seq
MIRT1397656	hsa-miR-4426	CLIP-seq
MIRT2341371	hsa-miR-4496	CLIP-seq
MIRT2341372	hsa-miR-4504	CLIP-seq
MIRT1397658	hsa-miR-4529-5p	CLIP-seq
MIRT1397660	hsa-miR-4647	CLIP-seq
MIRT1397662	hsa-miR-4662b	CLIP-seq
MIRT2341373	hsa-miR-4666-3p	CLIP-seq
MIRT2341374	hsa-miR-4727-5p	CLIP-seq
MIRT2341375	hsa-miR-4793-5p	CLIP-seq
MIRT2341376	hsa-miR-542-3p	CLIP-seq
MIRT2341377	hsa-miR-549	CLIP-seq
MIRT1397679	hsa-miR-590-5p	CLIP-seq
MIRT1397628	hsa-miR-1	CLIP-seq
MIRT2635347	hsa-miR-1257	CLIP-seq
MIRT2635348	hsa-miR-1285	CLIP-seq
MIRT1397630	hsa-miR-129-3p	CLIP-seq
MIRT1397632	hsa-miR-137	CLIP-seq
MIRT1397633	hsa-miR-141	CLIP-seq
MIRT2635349	hsa-miR-186	CLIP-seq
MIRT2635350	hsa-miR-192	CLIP-seq
MIRT1397637	hsa-miR-194	CLIP-seq
MIRT2635351	hsa-miR-197	CLIP-seq
MIRT1397640	hsa-miR-200a	CLIP-seq
MIRT2635352	hsa-miR-205	CLIP-seq
MIRT1397641	hsa-miR-206	CLIP-seq
MIRT2635353	hsa-miR-2117	CLIP-seq
MIRT2635354	hsa-miR-215	CLIP-seq
MIRT2635355	hsa-miR-2355-3p	CLIP-seq
MIRT2635356	hsa-miR-28-3p	CLIP-seq
MIRT1397644	hsa-miR-298	CLIP-seq
MIRT2341363	hsa-miR-3121-3p	CLIP-seq
MIRT2341364	hsa-miR-3122	CLIP-seq
MIRT2635357	hsa-miR-3123	CLIP-seq
MIRT2635358	hsa-miR-3124-3p	CLIP-seq
MIRT2635359	hsa-miR-3133	CLIP-seq
MIRT1397645	hsa-miR-3158-5p	CLIP-seq
MIRT2635360	hsa-miR-3159	CLIP-seq
MIRT2635361	hsa-miR-3160-5p	CLIP-seq
MIRT1397646	hsa-miR-3162-3p	CLIP-seq
MIRT1397647	hsa-miR-3187-3p	CLIP-seq
MIRT2635362	hsa-miR-3187-5p	CLIP-seq
MIRT2635363	hsa-miR-330-3p	CLIP-seq
MIRT2635364	hsa-miR-337-3p	CLIP-seq
MIRT2341365	hsa-miR-338-5p	CLIP-seq
MIRT2635365	hsa-miR-3655	CLIP-seq
MIRT2635366	hsa-miR-3685	CLIP-seq
MIRT1397649	hsa-miR-3690	CLIP-seq
MIRT2635367	hsa-miR-375	CLIP-seq
MIRT2635368	hsa-miR-384	CLIP-seq
MIRT2341369	hsa-miR-3913-5p	CLIP-seq
MIRT2341370	hsa-miR-3936	CLIP-seq
MIRT1397650	hsa-miR-3941	CLIP-seq
MIRT2635369	hsa-miR-3945	CLIP-seq
MIRT1397652	hsa-miR-412	CLIP-seq
MIRT2635370	hsa-miR-4253	CLIP-seq
MIRT1397653	hsa-miR-4254	CLIP-seq
MIRT2635371	hsa-miR-4273	CLIP-seq
MIRT2635372	hsa-miR-4279	CLIP-seq
MIRT1397656	hsa-miR-4426	CLIP-seq
MIRT2635373	hsa-miR-4436b-3p	CLIP-seq
MIRT1397658	hsa-miR-4529-5p	CLIP-seq
MIRT1397659	hsa-miR-4643	CLIP-seq
MIRT1397660	hsa-miR-4647	CLIP-seq
MIRT1397661	hsa-miR-466	CLIP-seq
MIRT1397662	hsa-miR-4662b	CLIP-seq
MIRT2341373	hsa-miR-4666-3p	CLIP-seq
MIRT1397663	hsa-miR-4672	CLIP-seq
MIRT2635374	hsa-miR-4677-5p	CLIP-seq
MIRT1397667	hsa-miR-4724-3p	CLIP-seq
MIRT1397668	hsa-miR-4725-5p	CLIP-seq
MIRT2341374	hsa-miR-4727-5p	CLIP-seq
MIRT2635375	hsa-miR-4761-3p	CLIP-seq
MIRT1397669	hsa-miR-4789-3p	CLIP-seq
MIRT1397670	hsa-miR-4803	CLIP-seq
MIRT2635376	hsa-miR-494	CLIP-seq
MIRT1397671	hsa-miR-504	CLIP-seq
MIRT1397674	hsa-miR-548ae	CLIP-seq
MIRT1397675	hsa-miR-548aj	CLIP-seq
MIRT1397676	hsa-miR-548am	CLIP-seq
MIRT2635377	hsa-miR-548c-3p	CLIP-seq
MIRT1397677	hsa-miR-548l	CLIP-seq
MIRT2635378	hsa-miR-548p	CLIP-seq
MIRT1397678	hsa-miR-548x	CLIP-seq
MIRT2635379	hsa-miR-612	CLIP-seq
MIRT1397680	hsa-miR-613	CLIP-seq
MIRT2635380	hsa-miR-619	CLIP-seq
MIRT2635381	hsa-miR-651	CLIP-seq
MIRT2635382	hsa-miR-668	CLIP-seq
MIRT2635383	hsa-miR-676	CLIP-seq
MIRT1397681	hsa-miR-875-3p	CLIP-seq
MIRT2635384	hsa-miR-922	CLIP-seq
MIRT1397628	hsa-miR-1	CLIP-seq
MIRT2635347	hsa-miR-1257	CLIP-seq
MIRT2635348	hsa-miR-1285	CLIP-seq
MIRT1397632	hsa-miR-137	CLIP-seq
MIRT2635349	hsa-miR-186	CLIP-seq
MIRT2635350	hsa-miR-192	CLIP-seq
MIRT2635351	hsa-miR-197	CLIP-seq
MIRT2635352	hsa-miR-205	CLIP-seq
MIRT1397641	hsa-miR-206	CLIP-seq
MIRT2635353	hsa-miR-2117	CLIP-seq
MIRT2635354	hsa-miR-215	CLIP-seq
MIRT2635355	hsa-miR-2355-3p	CLIP-seq
MIRT2635356	hsa-miR-28-3p	CLIP-seq
MIRT2341363	hsa-miR-3121-3p	CLIP-seq
MIRT2341364	hsa-miR-3122	CLIP-seq
MIRT2635357	hsa-miR-3123	CLIP-seq
MIRT2635358	hsa-miR-3124-3p	CLIP-seq
MIRT2635359	hsa-miR-3133	CLIP-seq
MIRT2635360	hsa-miR-3159	CLIP-seq
MIRT2635361	hsa-miR-3160-5p	CLIP-seq
MIRT1397646	hsa-miR-3162-3p	CLIP-seq
MIRT2635362	hsa-miR-3187-5p	CLIP-seq
MIRT2635363	hsa-miR-330-3p	CLIP-seq
MIRT2635364	hsa-miR-337-3p	CLIP-seq
MIRT2341365	hsa-miR-338-5p	CLIP-seq
MIRT2635365	hsa-miR-3655	CLIP-seq
MIRT2635366	hsa-miR-3685	CLIP-seq
MIRT1397649	hsa-miR-3690	CLIP-seq
MIRT2635367	hsa-miR-375	CLIP-seq
MIRT2635368	hsa-miR-384	CLIP-seq
MIRT2341369	hsa-miR-3913-5p	CLIP-seq
MIRT2341370	hsa-miR-3936	CLIP-seq
MIRT2635369	hsa-miR-3945	CLIP-seq
MIRT1397652	hsa-miR-412	CLIP-seq
MIRT2635370	hsa-miR-4253	CLIP-seq
MIRT1397653	hsa-miR-4254	CLIP-seq
MIRT2635371	hsa-miR-4273	CLIP-seq
MIRT2635372	hsa-miR-4279	CLIP-seq
MIRT2635373	hsa-miR-4436b-3p	CLIP-seq
MIRT2341373	hsa-miR-4666-3p	CLIP-seq
MIRT2635374	hsa-miR-4677-5p	CLIP-seq
MIRT1397667	hsa-miR-4724-3p	CLIP-seq
MIRT1397668	hsa-miR-4725-5p	CLIP-seq
MIRT2341374	hsa-miR-4727-5p	CLIP-seq
MIRT2635375	hsa-miR-4761-3p	CLIP-seq
MIRT2635376	hsa-miR-494	CLIP-seq
MIRT1397671	hsa-miR-504	CLIP-seq
MIRT1397674	hsa-miR-548ae	CLIP-seq
MIRT1397675	hsa-miR-548aj	CLIP-seq
MIRT1397676	hsa-miR-548am	CLIP-seq
MIRT2635377	hsa-miR-548c-3p	CLIP-seq
MIRT2635378	hsa-miR-548p	CLIP-seq
MIRT1397678	hsa-miR-548x	CLIP-seq
MIRT2635379	hsa-miR-612	CLIP-seq
MIRT1397680	hsa-miR-613	CLIP-seq
MIRT2635380	hsa-miR-619	CLIP-seq
MIRT2635381	hsa-miR-651	CLIP-seq
MIRT2635382	hsa-miR-668	CLIP-seq
MIRT2635383	hsa-miR-676	CLIP-seq
MIRT1397681	hsa-miR-875-3p	CLIP-seq
MIRT2635384	hsa-miR-922	CLIP-seq

81 Show/Hide all (81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	8566796
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001841	Process	Neural tube formation	IEA
GO:0003157	Process	Endocardium development	IEA
GO:0004672	Function	Protein kinase activity	IDA	28087714
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	11278283, 15109305, 15688006, 16930133
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8566796, 15688006, 18328708, 18362890, 19525978, 29063833, 30622739
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	14729613, 16930133, 18347058, 18362890, 20086174, 20562859, 20920251, 21104395, 21199877, 21988832, 23386615, 23455922, 23972470, 24255178, 24366813, 24929361, 24981860, 25416956, 28087714, 28514442, 29063833, 30622739, 31857374, 32296183, 32707033, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IDA	8566796
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	21145499
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	35429439
GO:0005737	Component	Cytoplasm	IDA	19525978, 21145499
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21076410
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	8566796
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006606	Process	Protein import into nucleus	IGI	16751106
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	11278283
GO:0007165	Process	Signal transduction	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	19962960
GO:0035265	Process	Organ growth	IEA
GO:0035329	Process	Hippo signaling	IDA	18328708, 35429439
GO:0035329	Process	Hippo signaling	IDA	15688006, 20412773, 29063833, 30622739
GO:0035329	Process	Hippo signaling	IEA
GO:0035329	Process	Hippo signaling	TAS	19484742
GO:0035332	Process	Positive regulation of hippo signaling	IDA	11118213, 22292086
GO:0035332	Process	Positive regulation of hippo signaling	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	8566796
GO:0042802	Function	Identical protein binding	IPI	20562859, 23972470
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043408	Process	Regulation of MAPK cascade	IBA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	TAS	20412773
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046621	Process	Negative regulation of organ growth	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	22292086
GO:0051262	Process	Protein tetramerization	IEA
GO:0051299	Process	Centrosome separation	IDA	18086858
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060215	Process	Primitive hemopoiesis	IEA
GO:0060706	Process	Cell differentiation involved in embryonic placenta development	IEA
GO:0060800	Process	Regulation of cell differentiation involved in embryonic placenta development	IEA
GO:0071539	Process	Protein localization to centrosome	IDA	21076410
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	20412773
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140537	Function	Transcription regulator activator activity	IGI	22292086
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA

MIM	HGNC	e!Ensembl
605030	11406	ENSG00000104375

Q13188

Protein name

Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) [Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-prot

Protein function

Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation (PubMed:11278283, PubMed:8566796, PubMed:8816758). Key component of th

PDB

3WWS , 4HKD , 4L0N , 4LG4 , 4LGD , 4OH9 , 5BRM , 5DH3 , 6AO5 , 6AR2 , 8A66

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11629	Mst1_SARAH	437 → 484	C terminal SARAH domain of Mst1	Family
PF00069	Pkinase	27 → 278	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in adult kidney, skeletal and placenta tissues and at very low levels in adult heart, lung and brain tissues. {ECO:0000269|PubMed:8566796}.

Sequence

MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF

Sequence length

491

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	Signaling by Hippo
Hippo signaling pathway
Hippo signaling pathway - multiple species

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	33632238	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	28498854	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

STK3 (serine/threonine kinase 3)

Bookmark This Gene