ST20 (suppressor of tumorigenicity 20)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 400410 |
| Gene name | Suppressor of tumorigenicity 20 |
| Gene symbol | ST20 |
| Synonyms (NCBI Gene) |
HCCS-1
|
| Chromosome | 15 |
| Chromosome location | 15q25.1 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9HBF5 |
| Protein name | Suppressor of tumorigenicity 20 protein (Human cervical cancer suppressor gene 1 protein) (HCCS-1) |
| Protein function | May act as a tumor suppressor. Promotes apoptosis of cancer cells. |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in leukocytes, lung, spleen, liver, heart, kidney, muscle and uterine cervix. Down-regulated in cervical cancer. {ECO:0000269|PubMed:11857354}. |
| Sequence |
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCE |
| Sequence length | 79 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ST20 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ST20 (see Related Genes above), that are NOT already directly curated for ST20 itself -- a lead worth checking, not a confirmed association.
0
|
|