ST13P4 (ST13, Hsp70 interacting protein pseudogene 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 145165
Gene name ST13, Hsp70 interacting protein pseudogene 4
Gene symbol ST13P4
Synonyms (NCBI Gene)
FAM10A4FAM10A4P
Chromosome 13
Chromosome location 13q14.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0046983 Function Protein dimerization activity IEA
GO:0070062 Component Extracellular exosome HDA 20458337
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 18487 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZP2
Protein name Putative protein FAM10A4 (Suppression of tumorigenicity 13 pseudogene 4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13181 TPR_8 144 → 177 Tetratricopeptide repeat Repeat
PF18253 HipN 2 → 42 Hsp70-interacting protein N N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in bone marrow and weakly in placenta, pancreas, heart and HeLa cell line. {ECO:0000269|PubMed:12079276}.
Sequence 
MDPRKVNELRAFVKMCKKDPSILHTQEMRFLREWVESMGGTATQKAKSEENTKEEKPDSK
VEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEA
LNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQP
YKRRGKAHRLLGHWEEAAHDLALACKFDYDEDASAMLKEVQPRAQKIAEHQRKYERKREE
Sequence length 240
Interactions View interactions

No strongly related genes found yet for ST13P4.

No additional diseases found yet through genes similar to ST13P4.