SSX9P (SSX family member 9, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 280660
Gene name SSX family member 9, pseudogene
Gene symbol SSX9P
Synonyms (NCBI Gene)
SSX9
Chromosome X
Chromosome location Xp11.23
Summary The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300544 19655 ENSG00000290708
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7RTT3
Protein name Putative protein SSX9
Protein function Could act as a modulator of transcription.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09514 SSXRD 157 → 187 SSXRD motif Motif
Tissue specificity TISSUE SPECIFICITY: Not detected in any normal or tumor tissues. {ECO:0000269|PubMed:12216073}.
Sequence 
MNGDDAFARRPRAGSQIPEKIQKAFDDIAKYFSKKEWEKMKSSEKIIYVYMKRKYEAMTK
LGFKATLPPFMCNTGATDLQGNDFDNDRNHRNQVERSQMTFGRLQGIFPKIMPKKPAEVG
NDSKEVPEASGLQNDGKQLCPPGKPTTSEKINKASGPKRGKHAWTHRLRERKQLVIYEEI
SDPEEDDE
Sequence length 188
Interactions View interactions

No strongly related genes found yet for SSX9P.

No additional diseases found yet through genes similar to SSX9P.