SSX8P (SSX family member 8, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 280659
Gene name SSX family member 8, pseudogene
Gene symbol SSX8P
Synonyms (NCBI Gene)
SSX8
Chromosome X
Chromosome location Xp11.22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300543 19654 ENSG00000290686
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7RTT4
Protein name Putative protein SSX8
Protein function Could act as a modulator of transcription.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 22 → 62 KRAB box Family
PF09514 SSXRD 157 → 186 SSXRD motif Motif
Tissue specificity TISSUE SPECIFICITY: Not detected in any normal or tumor tissues. {ECO:0000269|PubMed:12216073}.
Sequence 
MNGDDAFAKRPRDDDKASEKRSKAFNDIATYFSKKEWEKMKYSEKISYVYMKRNYEAMTK
LGFNVTLPPFMCNKQATDFQGNYFDNDRNRRIQVERPQMTFGRLQRIIPKIMPKKPAEEG
NDSKGVSEASGPQNDGKQLAPGKANTSEKINKRSGPKRGRHAWTHRLRERNQLVIYEEIR
DPEEDDE
Sequence length 187
Interactions View interactions

No strongly related genes found yet for SSX8P.

No additional diseases found yet through genes similar to SSX8P.