Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	280658
Gene name	SSX family member 7
Gene symbol	SSX7
Synonyms (NCBI Gene)	-
Chromosome	X
Chromosome location	Xp11.22
Summary	The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020425	hsa-miR-106b-5p	Microarray	17242205
MIRT029688	hsa-miR-26b-5p	Microarray	19088304
MIRT1393076	hsa-miR-134	CLIP-seq
MIRT1393077	hsa-miR-223	CLIP-seq
MIRT1393078	hsa-miR-3118	CLIP-seq
MIRT1393079	hsa-miR-3136-5p	CLIP-seq
MIRT1393080	hsa-miR-4276	CLIP-seq
MIRT1393081	hsa-miR-4439	CLIP-seq
MIRT1393082	hsa-miR-4513	CLIP-seq
MIRT1393083	hsa-miR-4697-3p	CLIP-seq
MIRT2118004	hsa-let-7a	CLIP-seq
MIRT2118005	hsa-let-7b	CLIP-seq
MIRT2118006	hsa-let-7c	CLIP-seq
MIRT2118007	hsa-let-7d	CLIP-seq
MIRT2118008	hsa-let-7e	CLIP-seq
MIRT2118009	hsa-let-7f	CLIP-seq
MIRT2118010	hsa-let-7g	CLIP-seq
MIRT2118011	hsa-let-7i	CLIP-seq
MIRT2118012	hsa-miR-202	CLIP-seq
MIRT2118013	hsa-miR-4303	CLIP-seq
MIRT2118014	hsa-miR-4458	CLIP-seq
MIRT2118015	hsa-miR-4500	CLIP-seq
MIRT2118016	hsa-miR-4649-3p	CLIP-seq
MIRT2118017	hsa-miR-4731-3p	CLIP-seq
MIRT2118018	hsa-miR-4801	CLIP-seq
MIRT2118019	hsa-miR-490-5p	CLIP-seq
MIRT2118020	hsa-miR-98	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA

MIM	HGNC	e!Ensembl
300542	19653	ENSG00000187754

Q7RTT5

Protein name

Protein SSX7

Protein function

Could act as a modulator of transcription.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09514	SSXRD	157 → 187	SSXRD motif	Motif

Tissue specificity

TISSUE SPECIFICITY: Testis-specific. Expressed in a melanoma cell line. {ECO:0000269|PubMed:12216073}.

Sequence

MNGDDAFARRPRAGAQIPEKIQKSFDDIAKYFSKKEWEKMKSLEKISYVYMKRKYEAMTK
LGFKATLPPFMHNTGATDLQGNDFDNDRNQGNQVERPQMTFCRLQRIFPKIMPKKPAEEG
NDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSGPKRGKHAWTHRLRERKQLVIYEEI
SDPEEDDE

Sequence length

188

Interactions

View interactions

KEGG Pathway
Transcriptional misregulation in cancer

Related Genes Genes most often co-reported with SSX7 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SSX7.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SSX7 (see Related Genes above), that are NOT already directly curated for SSX7 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SSX7.

SSX7 (SSX family member 7)

Bookmark This Gene