SSB (small RNA binding exonuclease protection factor La)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6741
• Gene name: Small RNA binding exonuclease protection factor La
• Gene symbol: SSB
• Synonyms (NCBI Gene): LARP3, La, La/SSB
• Chromosome: 2
• Chromosome location: 2q31.1
• Summary: The protein encoded by this gene is involved in diverse aspects of RNA metabolism, including binding and protecting poly(U) termini of nascent RNA polymerase III transcripts from exonuclease digestion, processing 5` and 3` ends of pre-tRNA precursors, act

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051494	hsa-let-7e-5p	CLASH	23622248
MIRT038547	hsa-miR-106b-3p	CLASH	23622248
MIRT203962	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT564372	hsa-miR-627-3p	PAR-CLIP	20371350
MIRT203961	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT564371	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT351566	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT203962	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT564372	hsa-miR-627-3p	PAR-CLIP	20371350
MIRT203961	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT564371	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT351566	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT1391603	hsa-miR-1279	CLIP-seq
MIRT1391604	hsa-miR-153	CLIP-seq
MIRT1391605	hsa-miR-181a	CLIP-seq
MIRT1391606	hsa-miR-181b	CLIP-seq
MIRT1391607	hsa-miR-181c	CLIP-seq
MIRT1391608	hsa-miR-181d	CLIP-seq
MIRT1391609	hsa-miR-216a	CLIP-seq
MIRT1391610	hsa-miR-374c	CLIP-seq
MIRT1391611	hsa-miR-4262	CLIP-seq
MIRT1391612	hsa-miR-448	CLIP-seq
MIRT1391613	hsa-miR-520d-5p	CLIP-seq
MIRT1391614	hsa-miR-524-5p	CLIP-seq
MIRT1391615	hsa-miR-548an	CLIP-seq
MIRT1391616	hsa-miR-579	CLIP-seq
MIRT1391617	hsa-miR-655	CLIP-seq
MIRT1391610	hsa-miR-374c	CLIP-seq
MIRT1391617	hsa-miR-655	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IMP	10983981
GO:0000049	Function	TRNA binding	TAS	10983981
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0001682	Process	TRNA 5'-leader removal	IGI	10983981
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IMP	3192525
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	TAS	9154801
GO:0005515	Function	Protein binding	IPI	23552417, 24965446, 25616068, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17308035, 24965446
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	17308035
GO:0005829	Component	Cytosol	IBA
GO:0006396	Process	RNA processing	IEA
GO:0006400	Process	TRNA modification	TAS	10983981
GO:0006409	Process	TRNA export from nucleus	IMP	17308035
GO:0008033	Process	TRNA processing	IBA
GO:0008033	Process	TRNA processing	IMP	17308035
GO:0008266	Function	Poly(U) RNA binding	IMP	12842046, 15004549, 16387655
GO:0008266	Function	Poly(U) RNA binding	IPI	12842046
GO:0008334	Process	Histone mRNA metabolic process	TAS	9154801
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:0042780	Process	TRNA 3'-end processing	IGI	10983981
GO:0045727	Process	Positive regulation of translation	IBA
GO:0071045	Process	Nuclear histone mRNA catabolic process	IMP	9154801
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	12384597
GO:1903608	Process	Protein localization to cytoplasmic stress granule	IDA	24965446
GO:1990825	Function	Sequence-specific mRNA binding	IMP	9154801
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:1990904	Component	Ribonucleoprotein complex	TAS	3192525

Other IDs

• MIM: 109090
• HGNC: 11316
• e!Ensembl: ENSG00000138385

Protein

• UniProt ID: P05455
• Protein name: Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B)
• Protein function: Binds to the 3' poly(U) terminus of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation (PubMed:2470590, PubMed:3192525). In case of Coxsackievirus B3 infection, binds
• PDB: 1OWX , 1S79 , 1S7A , 1YTY , 1ZH5 , 2VOD , 2VON , 2VOO , 2VOP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	113 → 181	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF05383	La	17 → 74	La domain	Domain
  PF08777	RRM_3	231 → 334	RNA binding motif	Domain

• Sequence:

  MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNR
  LTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPT
  DATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDL
  LILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDL
  DDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE
  VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGK
  KTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ

• Sequence length: 408

Pathways

KEGG Pathway:

Systemic lupus erythematosus

Related Genes

No strongly related genes found yet for SSB.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SSB.