Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6730
Gene name	Signal recognition particle 68
Gene symbol	SRP68
Synonyms (NCBI Gene)	SCN10
Chromosome	17
Chromosome location	17q25.1
Summary	This gene encodes a subunit of the signal recognition particle (SRP). The SRP is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits

208 Show/Hide all (208)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031372	hsa-miR-16-5p	Proteomics	18668040
MIRT046920	hsa-miR-221-3p	CLASH	23622248
MIRT044563	hsa-miR-320a	CLASH	23622248
MIRT044023	hsa-miR-365a-3p	CLASH	23622248
MIRT040611	hsa-miR-92b-3p	CLASH	23622248
MIRT036207	hsa-miR-320b	CLASH	23622248
MIRT442185	hsa-miR-548an	PAR-CLIP	22291592
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22291592
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22291592
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22291592
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22291592
MIRT442185	hsa-miR-548an	PAR-CLIP	22291592
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22291592
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22291592
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22291592
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22291592
MIRT442185	hsa-miR-548an	PAR-CLIP	23708386
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	23708386
MIRT442183	hsa-miR-888-3p	PAR-CLIP	23708386
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	23708386
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	23708386
MIRT442185	hsa-miR-548an	PAR-CLIP	22100165
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22100165
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22100165
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22100165
MIRT442185	hsa-miR-548an	PAR-CLIP	22100165
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22100165
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22100165
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22100165
MIRT442185	hsa-miR-548an	PAR-CLIP	22291592
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22291592
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22291592
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22291592
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22291592
MIRT442185	hsa-miR-548an	PAR-CLIP	22291592
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22291592
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22291592
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22291592
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22291592
MIRT442185	hsa-miR-548an	PAR-CLIP	23708386
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	23708386
MIRT442183	hsa-miR-888-3p	PAR-CLIP	23708386
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	23708386
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	23708386
MIRT442185	hsa-miR-548an	PAR-CLIP	22100165
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22100165
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22100165
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22100165
MIRT442185	hsa-miR-548an	PAR-CLIP	22100165
MIRT442184	hsa-miR-3912-3p	PAR-CLIP	22100165
MIRT442183	hsa-miR-888-3p	PAR-CLIP	22100165
MIRT442182	hsa-miR-3140-5p	PAR-CLIP	22100165
MIRT442181	hsa-miR-3653-5p	PAR-CLIP	22100165
MIRT1389219	hsa-miR-1290	CLIP-seq
MIRT1389220	hsa-miR-194	CLIP-seq
MIRT1389221	hsa-miR-3152-5p	CLIP-seq
MIRT1389222	hsa-miR-3166	CLIP-seq
MIRT1389223	hsa-miR-3167	CLIP-seq
MIRT1389224	hsa-miR-3659	CLIP-seq
MIRT1389225	hsa-miR-3661	CLIP-seq
MIRT1389226	hsa-miR-3912	CLIP-seq
MIRT1389227	hsa-miR-3918	CLIP-seq
MIRT1389228	hsa-miR-4303	CLIP-seq
MIRT1389229	hsa-miR-4658	CLIP-seq
MIRT1389230	hsa-miR-4671-5p	CLIP-seq
MIRT1389231	hsa-miR-4682	CLIP-seq
MIRT1389232	hsa-miR-4762-3p	CLIP-seq
MIRT1389233	hsa-miR-4771	CLIP-seq
MIRT1389234	hsa-miR-4774-3p	CLIP-seq
MIRT1389235	hsa-miR-4803	CLIP-seq
MIRT1389236	hsa-miR-574-5p	CLIP-seq
MIRT1389237	hsa-miR-619	CLIP-seq
MIRT1389238	hsa-miR-631	CLIP-seq
MIRT1389239	hsa-miR-659	CLIP-seq
MIRT1389240	hsa-miR-876-5p	CLIP-seq
MIRT1389241	hsa-miR-889	CLIP-seq
MIRT1389220	hsa-miR-194	CLIP-seq
MIRT1389224	hsa-miR-3659	CLIP-seq
MIRT1389228	hsa-miR-4303	CLIP-seq
MIRT1389229	hsa-miR-4658	CLIP-seq
MIRT1389231	hsa-miR-4682	CLIP-seq
MIRT1389232	hsa-miR-4762-3p	CLIP-seq
MIRT1389235	hsa-miR-4803	CLIP-seq
MIRT1389236	hsa-miR-574-5p	CLIP-seq
MIRT2339017	hsa-miR-4705	CLIP-seq
MIRT2632684	hsa-miR-1178	CLIP-seq
MIRT2632685	hsa-miR-1202	CLIP-seq
MIRT1389219	hsa-miR-1290	CLIP-seq
MIRT2632686	hsa-miR-1324	CLIP-seq
MIRT2632687	hsa-miR-1909	CLIP-seq
MIRT2632688	hsa-miR-1915	CLIP-seq
MIRT2632689	hsa-miR-2681	CLIP-seq
MIRT1389222	hsa-miR-3166	CLIP-seq
MIRT1389223	hsa-miR-3167	CLIP-seq
MIRT2632690	hsa-miR-3177-5p	CLIP-seq
MIRT2632691	hsa-miR-3179	CLIP-seq
MIRT2632692	hsa-miR-3189-5p	CLIP-seq
MIRT2632693	hsa-miR-3192	CLIP-seq
MIRT2632694	hsa-miR-342-5p	CLIP-seq
MIRT2632695	hsa-miR-3653	CLIP-seq
MIRT2632696	hsa-miR-3658	CLIP-seq
MIRT1389225	hsa-miR-3661	CLIP-seq
MIRT2632697	hsa-miR-3689a-3p	CLIP-seq
MIRT2632698	hsa-miR-3689c	CLIP-seq
MIRT2632699	hsa-miR-3689d	CLIP-seq
MIRT2632700	hsa-miR-3690	CLIP-seq
MIRT2632701	hsa-miR-376a	CLIP-seq
MIRT2632702	hsa-miR-376b	CLIP-seq
MIRT1389227	hsa-miR-3918	CLIP-seq
MIRT2632703	hsa-miR-3922-5p	CLIP-seq
MIRT2632704	hsa-miR-3929	CLIP-seq
MIRT2632705	hsa-miR-3972	CLIP-seq
MIRT2632706	hsa-miR-4254	CLIP-seq
MIRT2632707	hsa-miR-4314	CLIP-seq
MIRT2632708	hsa-miR-4419b	CLIP-seq
MIRT2632709	hsa-miR-4420	CLIP-seq
MIRT2632710	hsa-miR-4459	CLIP-seq
MIRT2632711	hsa-miR-4462	CLIP-seq
MIRT2632712	hsa-miR-4478	CLIP-seq
MIRT2632713	hsa-miR-4511	CLIP-seq
MIRT2632714	hsa-miR-4651	CLIP-seq
MIRT2632715	hsa-miR-4664-5p	CLIP-seq
MIRT2632716	hsa-miR-4667-5p	CLIP-seq
MIRT1389230	hsa-miR-4671-5p	CLIP-seq
MIRT2632717	hsa-miR-4700-3p	CLIP-seq
MIRT2632718	hsa-miR-4700-5p	CLIP-seq
MIRT2339017	hsa-miR-4705	CLIP-seq
MIRT2632719	hsa-miR-4720-3p	CLIP-seq
MIRT2632720	hsa-miR-4726-3p	CLIP-seq
MIRT2632721	hsa-miR-4728-5p	CLIP-seq
MIRT2632722	hsa-miR-4731-3p	CLIP-seq
MIRT2632723	hsa-miR-4731-5p	CLIP-seq
MIRT2632724	hsa-miR-4738-3p	CLIP-seq
MIRT2632725	hsa-miR-4768-3p	CLIP-seq
MIRT1389233	hsa-miR-4771	CLIP-seq
MIRT2632726	hsa-miR-4801	CLIP-seq
MIRT2632727	hsa-miR-4804-3p	CLIP-seq
MIRT2632728	hsa-miR-490-5p	CLIP-seq
MIRT2632729	hsa-miR-498	CLIP-seq
MIRT2632730	hsa-miR-503	CLIP-seq
MIRT2632731	hsa-miR-513a-5p	CLIP-seq
MIRT2632732	hsa-miR-513c	CLIP-seq
MIRT2632733	hsa-miR-514b-5p	CLIP-seq
MIRT2632734	hsa-miR-548b-3p	CLIP-seq
MIRT2632735	hsa-miR-550a	CLIP-seq
MIRT2632736	hsa-miR-577	CLIP-seq
MIRT2632737	hsa-miR-608	CLIP-seq
MIRT1389237	hsa-miR-619	CLIP-seq
MIRT1389238	hsa-miR-631	CLIP-seq
MIRT2632738	hsa-miR-637	CLIP-seq
MIRT2632739	hsa-miR-665	CLIP-seq
MIRT1389240	hsa-miR-876-5p	CLIP-seq
MIRT1389241	hsa-miR-889	CLIP-seq
MIRT2691992	hsa-miR-1254	CLIP-seq
MIRT1389219	hsa-miR-1290	CLIP-seq
MIRT2632686	hsa-miR-1324	CLIP-seq
MIRT2632687	hsa-miR-1909	CLIP-seq
MIRT2691993	hsa-miR-3116	CLIP-seq
MIRT1389222	hsa-miR-3166	CLIP-seq
MIRT1389223	hsa-miR-3167	CLIP-seq
MIRT2632690	hsa-miR-3177-5p	CLIP-seq
MIRT2632691	hsa-miR-3179	CLIP-seq
MIRT2632692	hsa-miR-3189-5p	CLIP-seq
MIRT2632693	hsa-miR-3192	CLIP-seq
MIRT2632694	hsa-miR-342-5p	CLIP-seq
MIRT2691994	hsa-miR-3650	CLIP-seq
MIRT2632695	hsa-miR-3653	CLIP-seq
MIRT2632696	hsa-miR-3658	CLIP-seq
MIRT1389225	hsa-miR-3661	CLIP-seq
MIRT2632697	hsa-miR-3689a-3p	CLIP-seq
MIRT2632698	hsa-miR-3689c	CLIP-seq
MIRT2632699	hsa-miR-3689d	CLIP-seq
MIRT1389227	hsa-miR-3918	CLIP-seq
MIRT2632703	hsa-miR-3922-5p	CLIP-seq
MIRT2632704	hsa-miR-3929	CLIP-seq
MIRT2632707	hsa-miR-4314	CLIP-seq
MIRT2632708	hsa-miR-4419b	CLIP-seq
MIRT2632709	hsa-miR-4420	CLIP-seq
MIRT2632711	hsa-miR-4462	CLIP-seq
MIRT2632712	hsa-miR-4478	CLIP-seq
MIRT2632713	hsa-miR-4511	CLIP-seq
MIRT2632714	hsa-miR-4651	CLIP-seq
MIRT2632715	hsa-miR-4664-5p	CLIP-seq
MIRT2632716	hsa-miR-4667-5p	CLIP-seq
MIRT1389230	hsa-miR-4671-5p	CLIP-seq
MIRT2632718	hsa-miR-4700-5p	CLIP-seq
MIRT2339017	hsa-miR-4705	CLIP-seq
MIRT2632719	hsa-miR-4720-3p	CLIP-seq
MIRT2632721	hsa-miR-4728-5p	CLIP-seq
MIRT2632722	hsa-miR-4731-3p	CLIP-seq
MIRT2632724	hsa-miR-4738-3p	CLIP-seq
MIRT1389233	hsa-miR-4771	CLIP-seq
MIRT2632726	hsa-miR-4801	CLIP-seq
MIRT2632727	hsa-miR-4804-3p	CLIP-seq
MIRT2632729	hsa-miR-498	CLIP-seq
MIRT2632730	hsa-miR-503	CLIP-seq
MIRT2632731	hsa-miR-513a-5p	CLIP-seq
MIRT2632734	hsa-miR-548b-3p	CLIP-seq
MIRT2632735	hsa-miR-550a	CLIP-seq
MIRT2632737	hsa-miR-608	CLIP-seq
MIRT1389237	hsa-miR-619	CLIP-seq
MIRT1389238	hsa-miR-631	CLIP-seq
MIRT2632738	hsa-miR-637	CLIP-seq
MIRT2691995	hsa-miR-661	CLIP-seq
MIRT1389240	hsa-miR-876-5p	CLIP-seq

31 Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0005047	Function	Signal recognition particle binding	IBA
GO:0005047	Function	Signal recognition particle binding	IEA
GO:0005047	Function	Signal recognition particle binding	IPI	17254600
GO:0005515	Function	Protein binding	IPI	16672232, 24700861, 24965446, 32296183, 33961781, 35156780, 35271311, 36012204
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	TAS	10618370
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	10618370
GO:0005786	Component	Signal recognition particle, endoplasmic reticulum targeting	IBA
GO:0005786	Component	Signal recognition particle, endoplasmic reticulum targeting	IDA	18089836
GO:0005786	Component	Signal recognition particle, endoplasmic reticulum targeting	IEA
GO:0005786	Component	Signal recognition particle, endoplasmic reticulum targeting	TAS	10618370
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	TAS	10618370
GO:0005925	Component	Focal adhesion	IDA
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IBA
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IEA
GO:0008312	Function	7S RNA binding	IEA
GO:0008312	Function	7S RNA binding	IMP	27899666
GO:0009410	Process	Response to xenobiotic stimulus	IDA	18089836
GO:0019904	Function	Protein domain specific binding	IPI	27899666
GO:0030942	Function	Endoplasmic reticulum signal peptide binding	IEA
GO:0043022	Function	Ribosome binding	IMP	27899666
GO:0048500	Component	Signal recognition particle	IDA	27899666
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
604858	11302	ENSG00000167881

Q9UHB9

Protein name

Signal recognition particle subunit SRP68 (SRP68) (Signal recognition particle 68 kDa protein)

Protein function

Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER) (PubMed:34020957). The SRP complex interacts

PDB

4P3E , 4P3F , 5M72 , 5M73 , 5WRV , 7NFX , 7QWQ , 8QVW , 8QVX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16969	SRP68	75 → 598	RNA-binding signal recognition particle 68	Family

Sequence

MAAEKQVPGGGGGGGSGGGGGSGGGGSGGGRGAGGEENKENERPSAGSKANKEFGDSLSL
EILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEELLTD
NRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDA
KTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEI
SPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRG
RTVPVKIDKVRIFLLGLADNEAAIVQAESEETKERLFESMLSECRDAIQVVREELKPDQK
QRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPR
PQDLIRLYDIILQNLVELLQLPGLEEDKAFQKEIGLKTLVFKAYRCFFIAQSYVLVKKWS
EALVLYDRVLKYANEVNSDAGAFKNSLKDLPDVQELITQVRSEKCSLQAAAILDANDAHQ
TETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAF
PPLEDKLEQKTKSGLTGYIKGIFGFRS

Sequence length

627

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Protein export	SRP-dependent cotranslational protein targeting to membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neutropenia, severe congenital, 10, autosomal recessive	Pathogenic	rs2509675736	RCV003333699	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	16759393	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE CONGENITAL NEUTROPENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	16835338	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28369529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25921176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SRP19	3	["Severe congenital neutropenia","Congenital neutropenia","Neutropenia"]	2	["Protein export","SRP-dependent cotranslational protein targeting to membrane"]	3	["Disgenet (Severe congenital neutropenia)","Disgenet (Congenital neutropenia)","Disgenet (Neutropenia)"]
SRP54	2	["Severe congenital neutropenia","Congenital neutropenia"]	2	["Protein export","SRP-dependent cotranslational protein targeting to membrane"]	4	["ClinVar (Severe congenital neutropenia)","Disgenet (Severe congenital neutropenia)","Disgenet (Congenital neutropenia)","HPO (Severe congenital neutropenia)"]
JAGN1	3	["Severe congenital neutropenia","Congenital neutropenia","Neutropenia"]	0	[]	4	["ClinVar (Severe congenital neutropenia)","Disgenet (Congenital neutropenia)","Disgenet (Neutropenia)","HPO (Severe congenital neutropenia)"]
SEC61A1	4	["Severe congenital neutropenia","Congenital neutropenia","Craniofacial abnormalities","Neutropenia"]	1	["Protein export"]	7	["ClinVar (Severe congenital neutropenia)","Disgenet (Severe congenital neutropenia)","Disgenet (Congenital neutropenia)","CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)","Disgenet (Neutropenia)","HPO (Severe congenital neutropenia)"]
CSF3R	3	["Severe congenital neutropenia","Congenital neutropenia","Neutropenia"]	0	[]	5	["ClinVar (Severe congenital neutropenia)","Disgenet (Severe congenital neutropenia)","Disgenet (Congenital neutropenia)","Disgenet (Neutropenia)","HPO (Severe congenital neutropenia)"]

SRP68 (signal recognition particle 68)

Bookmark This Gene