Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	653464
Gene name	SLIT-ROBO Rho GTPase activating protein 2C
Gene symbol	SRGAP2C
Synonyms (NCBI Gene)	SRGAP2P1
Chromosome	1
Chromosome location	1p11.2
Summary	This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. This human-specific locus resulted from segmental duplication of the SLIT-ROBO Rho GTPase activating protein 2B locus. The encoded protein lacks the GTPase activating prote

miRTarBase ID	miRNA	Experiments	Reference
MIRT018505	hsa-miR-335-5p	Microarray	18185580

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0007399	Process	Nervous system development	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0021816	Process	Extension of a leading process involved in cell motility in cerebral cortex radial glia guided migration	IDA	22559944
GO:0021987	Process	Cerebral cortex development	IDA	27373832, 34707291
GO:0030336	Process	Negative regulation of cell migration	IBA
GO:0042803	Function	Protein homodimerization activity	IPI	22559944
GO:0043197	Component	Dendritic spine	IBA
GO:0046982	Function	Protein heterodimerization activity	IPI	22559944
GO:0051490	Process	Negative regulation of filopodium assembly	IDA	22559944
GO:0051963	Process	Regulation of synapse assembly	IBA
GO:0051963	Process	Regulation of synapse assembly	IDA	22559944, 31822692
GO:0051963	Process	Regulation of synapse assembly	IMP	22559944, 31822692
GO:0061000	Process	Negative regulation of dendritic spine development	IDA	22559944
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IDA	22559944, 31822692
GO:0098978	Component	Glutamatergic synapse	IMP	22559944, 31822692
GO:1904861	Process	Excitatory synapse assembly	IDA	27373832, 34707291
GO:1904862	Process	Inhibitory synapse assembly	IDA	27373832, 34707291
GO:2001224	Process	Positive regulation of neuron migration	IDA	22559944

MIM	HGNC	e!Ensembl
614704	30584	ENSG00000171943

P0DJJ0

Protein name

SLIT-ROBO Rho GTPase-activating protein 2C (SLIT-ROBO Rho GTPase activating protein 2 pseudogene 1)

Protein function

Human-specific protein that acts as a key modifier of cortical connectivity in the human brain (PubMed:22559944, PubMed:27373832, PubMed:34707291). Acts by inhibiting the functions of ancestral paralog SRGAP2/SRGAP2A, a postsynaptic protein that

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00611	FCH	31 → 115	Fes/CIP4, and EFC/F-BAR homology domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with higher expression in cerebellum (PubMed:22559943, PubMed:22559944). Probably expressed in fetal and adult neurons (at protein level) (PubMed:22559943). {ECO:0000269|PubMed:22559943, ECO:0000269|PubMed:225599

Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAEHFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKWESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPCSPDSTANVRIEEKHVRRSSVKKIEKMKEKHQAKYT
ENKLKAIKAQNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF

Sequence length

459

Interactions

View interactions

Related Genes Genes most often co-reported with SRGAP2C across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SRGAP2C.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SRGAP2C (see Related Genes above), that are NOT already directly curated for SRGAP2C itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SRGAP2C.

SRGAP2C (SLIT-ROBO Rho GTPase activating protein 2C)

Bookmark This Gene