Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	647135
Gene name	SLIT-ROBO Rho GTPase activating protein 2B
Gene symbol	SRGAP2B
Synonyms (NCBI Gene)	SRGAP2LSRGAP2P2
Chromosome	1
Chromosome location	1q21.1
Summary	This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. This human-specific locus resulted from incomplete segmental duplication of the SLIT-ROBO Rho GTPase activating protein 2 locus. The encoded protein lacks the GTPase activa

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0007399	Process	Nervous system development	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0030336	Process	Negative regulation of cell migration	IBA
GO:0043197	Component	Dendritic spine	IBA
GO:0051963	Process	Regulation of synapse assembly	IBA
GO:0051963	Process	Regulation of synapse assembly	IDA	31822692
GO:0051963	Process	Regulation of synapse assembly	IMP	31822692
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IDA	31822692
GO:0098978	Component	Glutamatergic synapse	IMP	31822692

MIM	HGNC	e!Ensembl
614703	35237	ENSG00000196369

P0DMP2

Protein name

SLIT-ROBO Rho GTPase-activating protein 2B (SLIT-ROBO Rho GTPase activating protein 2 pseudogene 2)

Protein function

May regulate cell migration and differentiation through interaction with and inhibition of SRGAP2 (PubMed:31822692). In contrast to SRGAP2C, it is not able to induce long-lasting changes in synaptic density throughout adulthood (PubMed:31822692)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00611	FCH	31 → 115	Fes/CIP4, and EFC/F-BAR homology domain	Family

Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTFLSAELN
LEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQP
VQSELLQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMES
VKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF

Sequence length

458

Interactions

View interactions

Related Genes Genes most often co-reported with SRGAP2B across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SRGAP2B.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SRGAP2B (see Related Genes above), that are NOT already directly curated for SRGAP2B itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SRGAP2B.

SRGAP2B (SLIT-ROBO Rho GTPase activating protein 2B)

Bookmark This Gene