SPX (spexin hormone)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80763
• Gene name: Spexin hormone
• Gene symbol: SPX
• Synonyms (NCBI Gene): C12orf39, SPX1
• Chromosome: 12
• Chromosome location: 12p12.1
• Summary: The protein encoded by this gene is a hormone involved in modulation of cardiovascular and renal function. It has also been shown in rats to cause weight loss. Several transcript variants have been found for this gene. [provided by RefSeq, Feb 2016]

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	ISS
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	24517231
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IMP	17284679
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17284679, 19193193, 24550067
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0010459	Process	Negative regulation of heart rate	ISS
GO:0030133	Component	Transport vesicle	IEA
GO:0031045	Component	Dense core granule	IDA	17284679
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031765	Function	Type 2 galanin receptor binding	IDA	24517231
GO:0031766	Function	Type 3 galanin receptor binding	IDA	24517231
GO:0032099	Process	Negative regulation of appetite	ISS
GO:0035814	Process	Negative regulation of renal sodium excretion	ISS
GO:0044539	Process	Long-chain fatty acid import into cell	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0051930	Process	Regulation of sensory perception of pain	ISS
GO:1904306	Process	Positive regulation of gastro-intestinal system smooth muscle contraction	IBA
GO:1904306	Process	Positive regulation of gastro-intestinal system smooth muscle contraction	IMP	17284679

Other IDs

• MIM: 619246
• HGNC: 28139
• e!Ensembl: ENSG00000134548

Protein

• UniProt ID: Q9BT56
• Protein name: Spexin (NPQ) (Neuropeptide Q) (Spexin hormone) [Cleaved into: Spexin-1; Spexin-2 (NPQ 53-70)]
• Protein function: Plays a role as a central modulator of cardiovascular and renal function and nociception. Also plays a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release (By similar
• PDB: 7XJL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15171	Spexin	27 → 116	Neuropeptide secretory protein family, NPQ, spexin	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the type I glomic cells within the carotid body (at protein level). Expressed predominantly in pancreas, testis, kidney, brain and placenta. Expressed in submucosal layer of esophagus and stomach fundus. {ECO:0000269|PubMe
• Sequence:

  MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRR
  KDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW

• Sequence length: 116

Pathways

KEGG Pathway:

Neuroactive ligand-receptor interaction

Related Genes

No strongly related genes found yet for SPX.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SPX.