SPRED3 (sprouty related EVH1 domain containing 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 399473
• Gene name: Sprouty related EVH1 domain containing 3
• Gene symbol: SPRED3
• Synonyms (NCBI Gene): Eve-3, spred-3
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a protein with a C-terminal Sprouty-like cysteine-rich domain (SRY) and an N-terminal Ena/Vasodilator-stimulated phosphoprotein (VASP) homology-1 (EVH-1) domain. The encoded protein is a member of a family of proteins that negatively reg

miRNA Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT720424	hsa-miR-4712-3p	HITS-CLIP	19536157
MIRT720423	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT720422	hsa-miR-370-3p	HITS-CLIP	19536157
MIRT720421	hsa-miR-6893-3p	HITS-CLIP	19536157
MIRT720420	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT720419	hsa-miR-6852-5p	HITS-CLIP	19536157
MIRT720418	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT720417	hsa-miR-3664-3p	HITS-CLIP	19536157
MIRT720416	hsa-miR-1266-5p	HITS-CLIP	19536157
MIRT720415	hsa-miR-4518	HITS-CLIP	19536157
MIRT720414	hsa-miR-626	HITS-CLIP	19536157
MIRT720413	hsa-miR-6876-3p	HITS-CLIP	19536157
MIRT720412	hsa-miR-3199	HITS-CLIP	19536157
MIRT720411	hsa-miR-8052	HITS-CLIP	19536157
MIRT720410	hsa-miR-365a-5p	HITS-CLIP	19536157
MIRT720409	hsa-miR-365b-5p	HITS-CLIP	19536157
MIRT720408	hsa-miR-615-5p	HITS-CLIP	19536157
MIRT720407	hsa-miR-1343-3p	HITS-CLIP	19536157
MIRT720406	hsa-miR-6783-3p	HITS-CLIP	19536157
MIRT720405	hsa-miR-580-3p	HITS-CLIP	19536157
MIRT546417	hsa-miR-5692a	PAR-CLIP	21572407
MIRT546416	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT546415	hsa-miR-4476	PAR-CLIP	21572407
MIRT546414	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT546413	hsa-miR-8063	PAR-CLIP	21572407
MIRT546412	hsa-miR-4698	PAR-CLIP	21572407
MIRT546411	hsa-miR-6077	PAR-CLIP	21572407
MIRT720424	hsa-miR-4712-3p	HITS-CLIP	19536157
MIRT720423	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT720422	hsa-miR-370-3p	HITS-CLIP	19536157
MIRT720421	hsa-miR-6893-3p	HITS-CLIP	19536157
MIRT720420	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT720419	hsa-miR-6852-5p	HITS-CLIP	19536157
MIRT720418	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT720417	hsa-miR-3664-3p	HITS-CLIP	19536157
MIRT720416	hsa-miR-1266-5p	HITS-CLIP	19536157
MIRT720415	hsa-miR-4518	HITS-CLIP	19536157
MIRT720414	hsa-miR-626	HITS-CLIP	19536157
MIRT720413	hsa-miR-6876-3p	HITS-CLIP	19536157
MIRT720412	hsa-miR-3199	HITS-CLIP	19536157
MIRT720411	hsa-miR-8052	HITS-CLIP	19536157
MIRT720410	hsa-miR-365a-5p	HITS-CLIP	19536157
MIRT720409	hsa-miR-365b-5p	HITS-CLIP	19536157
MIRT720408	hsa-miR-615-5p	HITS-CLIP	19536157
MIRT720407	hsa-miR-1343-3p	HITS-CLIP	19536157
MIRT720406	hsa-miR-6783-3p	HITS-CLIP	19536157
MIRT720405	hsa-miR-580-3p	HITS-CLIP	19536157
MIRT546417	hsa-miR-5692a	PAR-CLIP	21572407
MIRT546416	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT546415	hsa-miR-4476	PAR-CLIP	21572407
MIRT546414	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT546413	hsa-miR-8063	PAR-CLIP	21572407
MIRT546412	hsa-miR-4698	PAR-CLIP	21572407
MIRT546411	hsa-miR-6077	PAR-CLIP	21572407
MIRT1385885	hsa-miR-1238	CLIP-seq
MIRT1385886	hsa-miR-4328	CLIP-seq
MIRT1385887	hsa-miR-4691-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	ISS
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:1902532	Process	Negative regulation of intracellular signal transduction	IEA
GO:1902747	Process	Negative regulation of lens fiber cell differentiation	ISS

Other IDs

• MIM: 609293
• HGNC: 31041
• e!Ensembl: ENSG00000188766

Protein

• UniProt ID: Q2MJR0
• Protein name: Sprouty-related, EVH1 domain-containing protein 3 (Spred-3)
• Protein function: Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase (By similarity). Inhibits fibroblast growth factor (FGF)-induced retinal lens fiber differentiation, probably by inhibiting FGF-mediated phosphorylation of E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00568	WH1	1 → 110	WH1 domain	Domain
  PF05210	Sprouty	294 → 405	Sprouty protein (Spry)	Family

• Sequence:

  MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKT
  TLECTLKPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTP
  SSSSSSSSPSQDTAETPCPLTSHVDSDSSSSHSRQETPPSAAAAPIITMESASGFGPTTP
  PQRRRSSAQSYPPLLPFTGIPEPSEPLAGAGGLGWGGRGYEDYRRSGPPAPLALSTCVVR
  FAKTGALRGAALGPPAALPAPLTEAAPPAPPARPPPGPGPSSAPAKASPEAEEAARCVHC
  RALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDFSDPCACEPGH
  PRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAAR

• Sequence length: 410

Pathways

Reactome Pathway

Regulation of RAS by GAPs

RAS signaling downstream of NF1 loss-of-function variants

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SPRED1 2 shared pathwaysRegulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants Related via 2 shared pathways including Regulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants. SPRED2 2 shared pathwaysRegulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants Related via 2 shared pathways including Regulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants. NF1 2 shared pathwaysRegulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants Related via 2 shared pathways including Regulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants. NRAS 2 shared pathwaysRegulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants Related via 2 shared pathways including Regulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants. HRAS 2 shared pathwaysRegulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants Related via 2 shared pathways including Regulation of RAS by GAPs, RAS signaling downstream of NF1 loss-of-function variants.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SPRED1	0	[]	2	["Regulation of RAS by GAPs","RAS signaling downstream of NF1 loss-of-function variants"]	0	[]
SPRED2	0	[]	2	["Regulation of RAS by GAPs","RAS signaling downstream of NF1 loss-of-function variants"]	0	[]
NF1	0	[]	2	["Regulation of RAS by GAPs","RAS signaling downstream of NF1 loss-of-function variants"]	0	[]
NRAS	0	[]	2	["Regulation of RAS by GAPs","RAS signaling downstream of NF1 loss-of-function variants"]	0	[]
HRAS	0	[]	2	["Regulation of RAS by GAPs","RAS signaling downstream of NF1 loss-of-function variants"]	0	[]

Diseases Linked via Similar Genes

Desbuquois syndrome Linked via 5 of 5 related genesSPRED1, SPRED2, NF1, NRAS, HRAS Noonan syndrome Linked via 4 of 5 related genesSPRED1, SPRED2, NRAS, HRAS Costello syndrome Linked via 3 of 5 related genesSPRED1, NRAS, HRAS Squamous cell carcinoma Linked via 3 of 5 related genesSPRED2, NF1, HRAS Melanoma Linked via 3 of 5 related genesNF1, NRAS, HRAS

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Desbuquois syndrome	5	["SPRED1","SPRED2","NF1","NRAS","HRAS"]
Noonan syndrome	4	["SPRED1","SPRED2","NRAS","HRAS"]
Costello syndrome	3	["SPRED1","NRAS","HRAS"]
Squamous cell carcinoma	3	["SPRED2","NF1","HRAS"]
Melanoma	3	["NF1","NRAS","HRAS"]